BLASTX nr result
ID: Achyranthes23_contig00037968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00037968 (251 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006483860.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 61 2e-07 ref|XP_006483856.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 61 2e-07 ref|XP_006438382.1| hypothetical protein CICLE_v10032455mg [Citr... 61 2e-07 ref|XP_006438381.1| hypothetical protein CICLE_v10032455mg [Citr... 61 2e-07 gb|EMJ24099.1| hypothetical protein PRUPE_ppa009978mg [Prunus pe... 60 3e-07 gb|ESW26340.1| hypothetical protein PHAVU_003G111000g [Phaseolus... 57 2e-06 gb|AFK41622.1| unknown [Lotus japonicus] 57 3e-06 ref|XP_004514680.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 57 3e-06 ref|XP_006304469.1| hypothetical protein CARUB_v10011162mg [Caps... 57 3e-06 gb|AAF17652.1|AC009398_1 F20B24.2 [Arabidopsis thaliana] 57 3e-06 ref|NP_001031020.1| associated molecule with the SH3 domain of S... 57 3e-06 ref|NP_172530.2| associated molecule with the SH3 domain of STAM... 57 3e-06 ref|XP_002889820.1| hypothetical protein ARALYDRAFT_888336 [Arab... 57 3e-06 ref|NP_001077505.1| associated molecule with the SH3 domain of S... 57 3e-06 ref|XP_003613227.1| STAM-binding protein [Medicago truncatula] g... 56 6e-06 ref|XP_006584010.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 55 1e-05 gb|ESW29449.1| hypothetical protein PHAVU_002G071100g [Phaseolus... 55 1e-05 gb|ESW29445.1| hypothetical protein PHAVU_002G071100g [Phaseolus... 55 1e-05 ref|XP_004508167.1| PREDICTED: AMSH-like ubiquitin thioesterase ... 55 1e-05 gb|AFK36420.1| unknown [Medicago truncatula] 55 1e-05 >ref|XP_006483860.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X5 [Citrus sinensis] Length = 251 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D IYE CSHVYTN+NLRFEIFDLR Sbjct: 217 GFHPHKEPADGSPIYEHCSHVYTNSNLRFEIFDLR 251 >ref|XP_006483856.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X1 [Citrus sinensis] gi|568860708|ref|XP_006483857.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X2 [Citrus sinensis] gi|568860710|ref|XP_006483858.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X3 [Citrus sinensis] Length = 275 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D IYE CSHVYTN+NLRFEIFDLR Sbjct: 241 GFHPHKEPADGSPIYEHCSHVYTNSNLRFEIFDLR 275 >ref|XP_006438382.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] gi|567891725|ref|XP_006438383.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] gi|568860712|ref|XP_006483859.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X4 [Citrus sinensis] gi|557540578|gb|ESR51622.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] gi|557540579|gb|ESR51623.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] Length = 264 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D IYE CSHVYTN+NLRFEIFDLR Sbjct: 230 GFHPHKEPADGSPIYEHCSHVYTNSNLRFEIFDLR 264 >ref|XP_006438381.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] gi|568860716|ref|XP_006483861.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X6 [Citrus sinensis] gi|557540577|gb|ESR51621.1| hypothetical protein CICLE_v10032455mg [Citrus clementina] Length = 240 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D IYE CSHVYTN+NLRFEIFDLR Sbjct: 206 GFHPHKEPADGSPIYEHCSHVYTNSNLRFEIFDLR 240 >gb|EMJ24099.1| hypothetical protein PRUPE_ppa009978mg [Prunus persica] Length = 269 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH+ + D IYE CS+VYTN+NLRFEIFDLR Sbjct: 234 QGFHPHKETTDGSPIYEHCSNVYTNSNLRFEIFDLR 269 >gb|ESW26340.1| hypothetical protein PHAVU_003G111000g [Phaseolus vulgaris] Length = 512 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH S+D IYE CSHVY NANL+F++ DLR Sbjct: 475 RGFHPHEESSDGSPIYEHCSHVYMNANLKFDVVDLR 510 >gb|AFK41622.1| unknown [Lotus japonicus] Length = 88 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 KGFHPH+ ++ +YE CS+VY N+NLRFEIFDLR Sbjct: 53 KGFHPHKEPDNGNPVYEHCSNVYKNSNLRFEIFDLR 88 >ref|XP_004514680.1| PREDICTED: AMSH-like ubiquitin thioesterase 2-like isoform X1 [Cicer arietinum] Length = 235 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 KGFHPH+ ++ +Y+ CS+VY NANLRFEIFDLR Sbjct: 200 KGFHPHKEPDNGNLVYDHCSNVYKNANLRFEIFDLR 235 >ref|XP_006304469.1| hypothetical protein CARUB_v10011162mg [Capsella rubella] gi|482573180|gb|EOA37367.1| hypothetical protein CARUB_v10011162mg [Capsella rubella] Length = 222 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 188 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 222 >gb|AAF17652.1|AC009398_1 F20B24.2 [Arabidopsis thaliana] Length = 388 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 354 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 388 >ref|NP_001031020.1| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] gi|222424323|dbj|BAH20118.1| AT1G10600 [Arabidopsis thaliana] gi|332190486|gb|AEE28607.1| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] Length = 166 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 132 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 166 >ref|NP_172530.2| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] gi|75271673|sp|Q6NKP9.1|AMSH2_ARATH RecName: Full=AMSH-like ubiquitin thioesterase 2; AltName: Full=Deubiquitinating enzyme AMSH2 gi|46931320|gb|AAT06464.1| At1g10600 [Arabidopsis thaliana] gi|51969058|dbj|BAD43221.1| hypothetical protein [Arabidopsis thaliana] gi|332190485|gb|AEE28606.1| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] Length = 223 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 189 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 223 >ref|XP_002889820.1| hypothetical protein ARALYDRAFT_888336 [Arabidopsis lyrata subsp. lyrata] gi|297335662|gb|EFH66079.1| hypothetical protein ARALYDRAFT_888336 [Arabidopsis lyrata subsp. lyrata] Length = 223 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 189 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 223 >ref|NP_001077505.1| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] gi|332190487|gb|AEE28608.1| associated molecule with the SH3 domain of STAM 2 [Arabidopsis thaliana] Length = 222 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ D +YE CS+VY N+NLRFEIFDLR Sbjct: 188 GFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR 222 >ref|XP_003613227.1| STAM-binding protein [Medicago truncatula] gi|355514562|gb|AES96185.1| STAM-binding protein [Medicago truncatula] gi|388510592|gb|AFK43362.1| unknown [Medicago truncatula] Length = 235 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH+ ++ +YE CS+VY N+NLRFEIFDLR Sbjct: 200 RGFHPHKEPDNGNPVYEHCSNVYRNSNLRFEIFDLR 235 >ref|XP_006584010.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Glycine max] Length = 504 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH D IYE CSHVY NANL+F++ DLR Sbjct: 467 RGFHPHEEPEDGTPIYEHCSHVYMNANLKFDVVDLR 502 >gb|ESW29449.1| hypothetical protein PHAVU_002G071100g [Phaseolus vulgaris] gi|561030871|gb|ESW29450.1| hypothetical protein PHAVU_002G071100g [Phaseolus vulgaris] Length = 294 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ ++ +YE CS+VY N+NLRFEIFDLR Sbjct: 260 GFHPHKEPDNGNPVYEHCSNVYRNSNLRFEIFDLR 294 >gb|ESW29445.1| hypothetical protein PHAVU_002G071100g [Phaseolus vulgaris] gi|561030869|gb|ESW29448.1| hypothetical protein PHAVU_002G071100g [Phaseolus vulgaris] Length = 269 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -2 Query: 247 GFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 GFHPH+ ++ +YE CS+VY N+NLRFEIFDLR Sbjct: 235 GFHPHKEPDNGNPVYEHCSNVYRNSNLRFEIFDLR 269 >ref|XP_004508167.1| PREDICTED: AMSH-like ubiquitin thioesterase 3-like [Cicer arietinum] Length = 506 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH +D IYE CSHVY NAN++F++ DLR Sbjct: 469 RGFHPHEEPSDGSPIYEHCSHVYMNANMKFDVIDLR 504 >gb|AFK36420.1| unknown [Medicago truncatula] Length = 261 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -2 Query: 250 KGFHPHRTSNDERSIYEQCSHVYTNANLRFEIFDLR 143 +GFHPH +D IYE CSHVY NAN++F++ DLR Sbjct: 224 RGFHPHEEPSDGSPIYEHCSHVYMNANMKFDVLDLR 259