BLASTX nr result
ID: Achyranthes23_contig00037558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00037558 (595 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304648.2| hypothetical protein POPTR_0003s16280g [Popu... 59 7e-07 ref|XP_006438860.1| hypothetical protein CICLE_v10030535mg [Citr... 58 2e-06 ref|XP_006438858.1| hypothetical protein CICLE_v10030535mg [Citr... 58 2e-06 ref|XP_006438857.1| hypothetical protein CICLE_v10030535mg [Citr... 58 2e-06 >ref|XP_002304648.2| hypothetical protein POPTR_0003s16280g [Populus trichocarpa] gi|550343308|gb|EEE79627.2| hypothetical protein POPTR_0003s16280g [Populus trichocarpa] Length = 1247 Score = 59.3 bits (142), Expect = 7e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 Query: 237 MRDLYTFSYPQGYGGALYNLAWAQAVQNKPLNEVLVEFQKDD 362 +RDLY + GY LYNLAWAQAVQNKPLNE+ VE + DD Sbjct: 68 VRDLYKYQVGGGYMSGLYNLAWAQAVQNKPLNELFVEVEVDD 109 >ref|XP_006438860.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] gi|568858958|ref|XP_006483010.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 3-like [Citrus sinensis] gi|557541056|gb|ESR52100.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] Length = 1234 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 5/51 (9%) Frame = +3 Query: 228 RYW-MRDLYTFSYP---QGYGGALYNLAWAQAVQNKPLNEVLV-EFQKDDV 365 R W MRDLY YP +GYG L+NLAWAQAVQNKPLNE+ V E ++DDV Sbjct: 51 RVWTMRDLYN-KYPAICRGYGPGLHNLAWAQAVQNKPLNEIFVMEAEQDDV 100 >ref|XP_006438858.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] gi|557541054|gb|ESR52098.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] Length = 1208 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 5/51 (9%) Frame = +3 Query: 228 RYW-MRDLYTFSYP---QGYGGALYNLAWAQAVQNKPLNEVLV-EFQKDDV 365 R W MRDLY YP +GYG L+NLAWAQAVQNKPLNE+ V E ++DDV Sbjct: 51 RVWTMRDLYN-KYPAICRGYGPGLHNLAWAQAVQNKPLNEIFVMEAEQDDV 100 >ref|XP_006438857.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] gi|567892677|ref|XP_006438859.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] gi|557541053|gb|ESR52097.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] gi|557541055|gb|ESR52099.1| hypothetical protein CICLE_v10030535mg [Citrus clementina] Length = 1118 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 5/51 (9%) Frame = +3 Query: 228 RYW-MRDLYTFSYP---QGYGGALYNLAWAQAVQNKPLNEVLV-EFQKDDV 365 R W MRDLY YP +GYG L+NLAWAQAVQNKPLNE+ V E ++DDV Sbjct: 51 RVWTMRDLYN-KYPAICRGYGPGLHNLAWAQAVQNKPLNEIFVMEAEQDDV 100