BLASTX nr result
ID: Achyranthes23_contig00037417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00037417 (325 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533437.1| kinesin heavy chain, putative [Ricinus commu... 62 8e-08 >ref|XP_002533437.1| kinesin heavy chain, putative [Ricinus communis] gi|223526711|gb|EEF28944.1| kinesin heavy chain, putative [Ricinus communis] Length = 987 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/79 (37%), Positives = 55/79 (69%), Gaps = 2/79 (2%) Frame = -3 Query: 323 VMNLKQEIELLKRALDDKDERNSQPNR--QLRSPCDKARPILDKSPVKERRLSIENPGSM 150 +M LK+++E L++AL K+E+N+Q NR + RSPC+K + +++++P + RRLSIEN +M Sbjct: 686 IMQLKEQVETLRKALASKEEKNTQFNRMKEPRSPCEKPKEMMERTPPRLRRLSIENGSNM 745 Query: 149 RAKSPFRKPKPTDNDNART 93 ++++ P D ++T Sbjct: 746 KSQT----VNPIDRKGSKT 760