BLASTX nr result
ID: Achyranthes23_contig00037388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00037388 (260 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ25407.1| hypothetical protein PRUPE_ppa017410mg [Prunus pe... 110 2e-22 gb|EOY31362.1| DNAJ heat shock family protein [Theobroma cacao] 110 2e-22 ref|XP_006838799.1| hypothetical protein AMTR_s00002p00260500 [A... 108 6e-22 ref|XP_004291417.1| PREDICTED: dnaJ homolog subfamily B member 4... 108 1e-21 ref|XP_004173924.1| PREDICTED: dnaJ homolog subfamily B member 4... 108 1e-21 ref|XP_004136336.1| PREDICTED: dnaJ homolog subfamily B member 5... 108 1e-21 ref|XP_002311798.2| DNAJ heat shock family protein [Populus tric... 107 2e-21 ref|XP_006378170.1| DNAJ heat shock family protein [Populus tric... 107 2e-21 ref|XP_002311874.1| predicted protein [Populus trichocarpa] 107 2e-21 gb|ABK94880.1| unknown [Populus trichocarpa] 107 2e-21 ref|XP_006371721.1| hypothetical protein POPTR_0018s01070g [Popu... 106 4e-21 ref|XP_003631828.1| PREDICTED: dnaJ homolog subfamily B member 1... 106 4e-21 ref|XP_002284572.1| PREDICTED: dnaJ homolog subfamily B member 1... 106 4e-21 gb|ESW29654.1| hypothetical protein PHAVU_002G087900g [Phaseolus... 105 5e-21 ref|XP_006289060.1| hypothetical protein CARUB_v10002457mg [Caps... 105 5e-21 emb|CBI15287.3| unnamed protein product [Vitis vinifera] 105 5e-21 ref|XP_002270193.1| PREDICTED: dnaJ homolog subfamily B member 1... 105 5e-21 ref|XP_002520159.1| Curved DNA-binding protein, putative [Ricinu... 105 5e-21 ref|XP_004499435.1| PREDICTED: dnaJ homolog subfamily B member 1... 105 6e-21 gb|ABR16557.1| unknown [Picea sitchensis] 105 6e-21 >gb|EMJ25407.1| hypothetical protein PRUPE_ppa017410mg [Prunus persica] Length = 334 Score = 110 bits (276), Expect = 2e-22 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYN+LKVNR+AT+DDL+KAYRRLA+KWHPDKNPNNK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNVLKVNRNATEDDLKKAYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD 59 >gb|EOY31362.1| DNAJ heat shock family protein [Theobroma cacao] Length = 333 Score = 110 bits (275), Expect = 2e-22 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVN++ATDDDL+K+YRRLA+KWHPDKNPNNK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNILKVNKNATDDDLKKSYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD 59 >ref|XP_006838799.1| hypothetical protein AMTR_s00002p00260500 [Amborella trichopoda] gi|548841305|gb|ERN01368.1| hypothetical protein AMTR_s00002p00260500 [Amborella trichopoda] Length = 344 Score = 108 bits (271), Expect = 6e-22 Identities = 49/59 (83%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKV+R+ATD+DL+KAYRRLA+KWHPDKNPN+K EAEAKFK ISEA+DVLSD Sbjct: 1 MGVDYYNILKVSRNATDEDLKKAYRRLAMKWHPDKNPNSKKEAEAKFKQISEAYDVLSD 59 >ref|XP_004291417.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Fragaria vesca subsp. vesca] Length = 338 Score = 108 bits (269), Expect = 1e-21 Identities = 48/59 (81%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+AT+DDL+K+YRRLA+KWHPDKNPN+K EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNILKVNRNATEDDLKKSYRRLAMKWHPDKNPNDKKEAEAKFKQISEAYEVLSD 59 >ref|XP_004173924.1| PREDICTED: dnaJ homolog subfamily B member 4-like, partial [Cucumis sativus] Length = 308 Score = 108 bits (269), Expect = 1e-21 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A DDDL+KAYR+LA+KWHPDKNPNNK EAE KFK ISEA++VLSD Sbjct: 1 MGVDYYNILKVNRNANDDDLKKAYRKLAMKWHPDKNPNNKKEAETKFKQISEAYEVLSD 59 >ref|XP_004136336.1| PREDICTED: dnaJ homolog subfamily B member 5-like [Cucumis sativus] Length = 335 Score = 108 bits (269), Expect = 1e-21 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A DDDL+KAYR+LA+KWHPDKNPNNK EAE KFK ISEA++VLSD Sbjct: 1 MGVDYYNILKVNRNANDDDLKKAYRKLAMKWHPDKNPNNKKEAETKFKQISEAYEVLSD 59 >ref|XP_002311798.2| DNAJ heat shock family protein [Populus trichocarpa] gi|550333496|gb|EEE89165.2| DNAJ heat shock family protein [Populus trichocarpa] Length = 314 Score = 107 bits (266), Expect = 2e-21 Identities = 47/59 (79%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG DYYN+LK+NR+AT+DD++KAY+RLA+KWHPDKNP NK EAEAKFKLISEA+DVLSD Sbjct: 1 MGFDYYNVLKLNRNATEDDMKKAYKRLAMKWHPDKNPVNKKEAEAKFKLISEAYDVLSD 59 >ref|XP_006378170.1| DNAJ heat shock family protein [Populus trichocarpa] gi|550329041|gb|ERP55967.1| DNAJ heat shock family protein [Populus trichocarpa] Length = 317 Score = 107 bits (266), Expect = 2e-21 Identities = 47/59 (79%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILK+NR+AT++D++KAY+RLA+KWHPDKNP NK EAEAKFKLISEA+DVLSD Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDKNPVNKKEAEAKFKLISEAYDVLSD 59 >ref|XP_002311874.1| predicted protein [Populus trichocarpa] Length = 317 Score = 107 bits (266), Expect = 2e-21 Identities = 47/59 (79%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILK+NR+AT++D++KAY+RLA+KWHPDKNP NK EAEAKFKLISEA+DVLSD Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDKNPVNKKEAEAKFKLISEAYDVLSD 59 >gb|ABK94880.1| unknown [Populus trichocarpa] Length = 317 Score = 107 bits (266), Expect = 2e-21 Identities = 47/59 (79%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILK+NR+AT++D++KAY+RLA+KWHPDKNP NK EAEAKFKLISEA+DVLSD Sbjct: 1 MGVDYYNILKLNRNATEEDMKKAYKRLAMKWHPDKNPVNKKEAEAKFKLISEAYDVLSD 59 >ref|XP_006371721.1| hypothetical protein POPTR_0018s01070g [Populus trichocarpa] gi|550317764|gb|ERP49518.1| hypothetical protein POPTR_0018s01070g [Populus trichocarpa] Length = 334 Score = 106 bits (264), Expect = 4e-21 Identities = 48/59 (81%), Positives = 55/59 (93%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+ATD DL+K+YRRLA+KWHPDKNP NK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNILKVNRNATDGDLKKSYRRLAMKWHPDKNPTNKKEAEAKFKEISEAYEVLSD 59 >ref|XP_003631828.1| PREDICTED: dnaJ homolog subfamily B member 13 isoform 2 [Vitis vinifera] Length = 273 Score = 106 bits (264), Expect = 4e-21 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYN+LKV ++ATD+DL+K+YRRLA+KWHPDKNPNNK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNVLKVGKNATDEDLKKSYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD 59 >ref|XP_002284572.1| PREDICTED: dnaJ homolog subfamily B member 13 isoform 1 [Vitis vinifera] gi|296081929|emb|CBI20934.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 106 bits (264), Expect = 4e-21 Identities = 46/59 (77%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYN+LKV ++ATD+DL+K+YRRLA+KWHPDKNPNNK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNVLKVGKNATDEDLKKSYRRLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD 59 >gb|ESW29654.1| hypothetical protein PHAVU_002G087900g [Phaseolus vulgaris] Length = 329 Score = 105 bits (263), Expect = 5e-21 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A+DDDL+KAY+RLA WHPDKNP+NKSEAEAKFK ISEA+DVLSD Sbjct: 1 MGMDYYNILKVNRNASDDDLKKAYKRLARIWHPDKNPDNKSEAEAKFKRISEAYDVLSD 59 >ref|XP_006289060.1| hypothetical protein CARUB_v10002457mg [Capsella rubella] gi|482557766|gb|EOA21958.1| hypothetical protein CARUB_v10002457mg [Capsella rubella] Length = 339 Score = 105 bits (263), Expect = 5e-21 Identities = 47/59 (79%), Positives = 57/59 (96%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKV+R+AT+DDL+K+YRRLA+KWHPDKNPN K+EAEAKFK ISEA++VLSD Sbjct: 1 MGLDYYNILKVDRNATEDDLKKSYRRLAMKWHPDKNPNTKTEAEAKFKQISEAYEVLSD 59 >emb|CBI15287.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A++DDLR+AYRRLA+ WHPDKNP+NK EAEAKFK ISEA+DVLSD Sbjct: 11 MGVDYYNILKVNRNASEDDLRRAYRRLAMIWHPDKNPSNKREAEAKFKQISEAYDVLSD 69 >ref|XP_002270193.1| PREDICTED: dnaJ homolog subfamily B member 13-like isoform 1 [Vitis vinifera] Length = 339 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A++DDLR+AYRRLA+ WHPDKNP+NK EAEAKFK ISEA+DVLSD Sbjct: 1 MGVDYYNILKVNRNASEDDLRRAYRRLAMIWHPDKNPSNKREAEAKFKQISEAYDVLSD 59 >ref|XP_002520159.1| Curved DNA-binding protein, putative [Ricinus communis] gi|223540651|gb|EEF42214.1| Curved DNA-binding protein, putative [Ricinus communis] Length = 321 Score = 105 bits (263), Expect = 5e-21 Identities = 48/59 (81%), Positives = 54/59 (91%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR A DDDL++AY+RLA+KWHPDKNP NK EAEAKFK ISEA+DVLSD Sbjct: 1 MGVDYYNILKVNRKAADDDLKRAYKRLAMKWHPDKNPLNKKEAEAKFKQISEAYDVLSD 59 >ref|XP_004499435.1| PREDICTED: dnaJ homolog subfamily B member 1-like [Cicer arietinum] Length = 331 Score = 105 bits (262), Expect = 6e-21 Identities = 49/59 (83%), Positives = 56/59 (94%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYNILKVNR+A+D+DL+KAY+RLA+ WHPDKNP NKSEAEAKFK ISEAFDVLSD Sbjct: 1 MGMDYYNILKVNRNASDEDLKKAYKRLAMIWHPDKNPVNKSEAEAKFKRISEAFDVLSD 59 >gb|ABR16557.1| unknown [Picea sitchensis] Length = 336 Score = 105 bits (262), Expect = 6e-21 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = -2 Query: 178 MGIDYYNILKVNRHATDDDLRKAYRRLAIKWHPDKNPNNKSEAEAKFKLISEAFDVLSD 2 MG+DYYN+L V R+AT+DDL+KAYR+LA+KWHPDKNPNNK EAEAKFK ISEA++VLSD Sbjct: 1 MGVDYYNVLNVGRNATEDDLKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYEVLSD 59