BLASTX nr result
ID: Achyranthes23_contig00037009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00037009 (239 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI19635.1| hypothetical protein [uncultured delta proteobact... 74 2e-11 ref|WP_004984910.1| conserved hypothetical protein, partial [Str... 73 3e-11 ref|WP_009063254.1| conserved hypothetical protein, partial [Str... 72 8e-11 ref|WP_005311167.1| conserved hypothetical protein, partial [Str... 72 1e-10 ref|WP_007381065.1| conserved hypothetical protein, partial [Str... 71 2e-10 ref|WP_003975503.1| hypothetical protein [Streptomyces lividans]... 71 2e-10 ref|WP_005314063.1| conserved hypothetical protein, partial [Str... 70 3e-10 ref|WP_006123540.1| conserved hypothetical protein, partial [Str... 70 3e-10 ref|WP_003993384.1| hypothetical protein [Streptomyces viridochr... 69 5e-10 ref|WP_004930641.1| hypothetical protein [Streptomyces griseofla... 69 6e-10 ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] ... 69 6e-10 ref|WP_009714633.1| hypothetical protein, partial [Streptomyces ... 68 1e-09 ref|WP_008603367.1| cell wall-associated hydrolase, partial [Vei... 61 2e-09 ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella ... 61 2e-09 ref|WP_008715884.1| cell wall-associated hydrolase, partial [Vei... 61 2e-09 ref|WP_006805144.1| hypothetical protein [Leptotrichia hofstadii... 67 3e-09 gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bact... 66 4e-09 ref|WP_007385104.1| conserved hypothetical protein, partial [Str... 66 4e-09 ref|WP_009068222.1| conserved hypothetical protein, partial [Str... 65 1e-08 ref|WP_008748712.1| hypothetical protein, partial [Streptomyces ... 62 6e-08 >gb|ADI19635.1| hypothetical protein [uncultured delta proteobacterium HF0770_45N15] Length = 155 Score = 73.9 bits (180), Expect = 2e-11 Identities = 43/79 (54%), Positives = 51/79 (64%) Frame = +2 Query: 2 SRAISIG*LNASQRLHTQPINVVVSDGPSGNSRFQ*DLILRLVSRLDAFSGYLFRT*LPG 181 +R +S G L A R H +PI VV PSG++ + +L SRLDAFSG FRT LPG Sbjct: 63 TRPLSTGRLRALPRFHLRPIKQVVFLWPSGSAEALREEVLGGGSRLDAFSGSPFRTQLPG 122 Query: 182 NATGVTTGTPEVRPLRSSR 238 A G TTG+PEVRP RSSR Sbjct: 123 GAAGATTGSPEVRPPRSSR 141 >ref|WP_004984910.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291340927|gb|EFE67883.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291341606|gb|EFE68562.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342163|gb|EFE69119.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343781|gb|EFE70737.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 74 Score = 73.2 bits (178), Expect = 3e-11 Identities = 38/68 (55%), Positives = 44/68 (64%) Frame = +1 Query: 34 LTALTHPTYQRRSLRRPFRELKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTR 213 +T L P YQ L +V HLEA FPLRCFQRLSLPN+A + C W+DN +TR Sbjct: 7 VTVLPDPAYQPSRLLGALPH-QVGGSPHLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTR 65 Query: 214 GSSTPVLS 237 GSS PVLS Sbjct: 66 GSSVPVLS 73 >ref|WP_009063254.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302426768|gb|EFK98583.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429649|gb|EFL01465.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] gi|302429953|gb|EFL01769.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 74 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/68 (54%), Positives = 45/68 (66%) Frame = +1 Query: 34 LTALTHPTYQRRSLRRPFRELKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTR 213 LT L +P YQ L + +HLEA FPLRCFQRLSLPN+A + C W++N +TR Sbjct: 7 LTGLPYPAYQPSRLLGALPS-QGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTR 65 Query: 214 GSSTPVLS 237 GSS PVLS Sbjct: 66 GSSVPVLS 73 >ref|WP_005311167.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151020|gb|EDY65528.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151807|gb|EFH31361.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/70 (55%), Positives = 45/70 (64%), Gaps = 2/70 (2%) Frame = +1 Query: 34 LTALTHPTYQRRSL--RRPFRELKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRN 207 LT L +P YQ L P + P HLEA FPLRCFQRLS PN+A + C W+DN + Sbjct: 7 LTGLPYPAYQPSRLLGALPSQGGGSP---HLEAGFPLRCFQRLSFPNVANQPCPWQDNWH 63 Query: 208 TRGSSTPVLS 237 TRGSS PVLS Sbjct: 64 TRGSSVPVLS 73 >ref|WP_007381065.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297147181|gb|EFH28519.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147699|gb|EFH28707.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] gi|297147892|gb|EFH28779.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 74 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 HLEA FPLRCFQRLSLPN+A + C W+DN +TRGSS PVLS Sbjct: 33 HLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLS 73 >ref|WP_003975503.1| hypothetical protein [Streptomyces lividans] gi|289701157|gb|EFD68586.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289701450|gb|EFD68879.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289702690|gb|EFD70119.1| conserved hypothetical protein [Streptomyces lividans TK24] gi|289703100|gb|EFD70529.1| conserved hypothetical protein [Streptomyces lividans TK24] Length = 66 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 HLEA FPLRCFQRLSLPN+A + C W+DN +TRGSS PVLS Sbjct: 25 HLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVPVLS 65 >ref|WP_005314063.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151538|gb|EDY66056.2| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152877|gb|EFH32044.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 74 Score = 70.1 bits (170), Expect = 3e-10 Identities = 38/69 (55%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = +1 Query: 37 TALTHPTYQRRSL--RRPFRELKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNT 210 T L +P YQ L P + P HLEA FPLRCFQRLS PN+A + C W+DN +T Sbjct: 8 TGLPYPAYQPSRLLGALPSQGGGSP---HLEAGFPLRCFQRLSFPNVANQPCPWQDNWHT 64 Query: 211 RGSSTPVLS 237 RGSS PVLS Sbjct: 65 RGSSVPVLS 73 >ref|WP_006123540.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291346639|gb|EFE73543.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348565|gb|EFE75469.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291348853|gb|EFE75757.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 50 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/48 (66%), Positives = 37/48 (77%) Frame = +1 Query: 94 LKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 LK +HLEA FPLRCFQRLS PN+A + C W+DN +TRGSS PVLS Sbjct: 2 LKGGGNTHLEAGFPLRCFQRLSFPNVANQPCPWQDNWHTRGSSVPVLS 49 >ref|WP_003993384.1| hypothetical protein [Streptomyces viridochromogenes] gi|302472168|gb|EFL35261.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 66 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +1 Query: 112 SHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 +HLEA FPLRCFQRLSLPN+A + C W++N +TRGSS PVLS Sbjct: 24 THLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLS 65 >ref|WP_004930641.1| hypothetical protein [Streptomyces griseoflavus] gi|302477944|gb|EFL41037.1| hypothetical protein SSRG_03841 [Streptomyces griseoflavus Tu4000] Length = 66 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 HLEA FPLRCFQRLSLPN+A + C W++N +TRGSS PVLS Sbjct: 25 HLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLS 65 >ref|WP_009187877.1| hypothetical protein [Streptomyces sp. e14] gi|292830510|gb|EFF88860.1| hypothetical protein SSTG_04730 [Streptomyces sp. e14] gi|292831950|gb|EFF90299.1| hypothetical protein SSTG_00617 [Streptomyces sp. e14] gi|292833022|gb|EFF91371.1| hypothetical protein SSTG_01690 [Streptomyces sp. e14] gi|292833480|gb|EFF91829.1| hypothetical protein SSTG_02148 [Streptomyces sp. e14] gi|292834018|gb|EFF92367.1| hypothetical protein SSTG_02686 [Streptomyces sp. e14] Length = 66 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 HLEA FPLRCFQRLSLPN+A + C W++N +TRGSS PVLS Sbjct: 25 HLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSSVPVLS 65 >ref|WP_009714633.1| hypothetical protein, partial [Streptomyces himastatinicus] gi|302459719|gb|EFL22812.1| LOW QUALITY PROTEIN: hypothetical protein SSOG_02526 [Streptomyces himastatinicus ATCC 53653] Length = 74 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 HLEA FPLRCFQRLSLPN+A + C W+DN +T GSS PVLS Sbjct: 33 HLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTGGSSVPVLS 73 >ref|WP_008603367.1| cell wall-associated hydrolase, partial [Veillonella sp. 6_1_27] gi|294456247|gb|EFG24611.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0874_01772, partial [Veillonella sp. 6_1_27] Length = 83 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 109 RSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 + HL+A F LRCFQRLS+PN+AT+ W+DN T GSSTPVLS Sbjct: 40 KPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLS 82 Score = 26.6 bits (57), Expect(2) = 2e-09 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 9 QLVLVSSTPHSAYTPNLST 65 +LV VSS PH + TP LST Sbjct: 8 RLVPVSSNPHGSSTPGLST 26 >ref|WP_008715863.1| cell wall-associated hydrolase [Veillonella sp. 3_1_44] gi|294453908|gb|EFG22289.1| hypothetical protein HMPREF0873_01868 [Veillonella sp. 3_1_44] Length = 94 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 109 RSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 + HL+A F LRCFQRLS+PN+AT+ W+DN T GSSTPVLS Sbjct: 51 KPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLS 93 Score = 26.2 bits (56), Expect(2) = 2e-09 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 9 QLVLVSSTPHSAYTPNLST 65 +LV VSS PH + TP LST Sbjct: 19 RLVPVSSKPHGSSTPGLST 37 >ref|WP_008715884.1| cell wall-associated hydrolase, partial [Veillonella sp. 3_1_44] gi|294453902|gb|EFG22286.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0873_01871, partial [Veillonella sp. 3_1_44] Length = 83 Score = 61.2 bits (147), Expect(2) = 2e-09 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 109 RSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 + HL+A F LRCFQRLS+PN+AT+ W+DN T GSSTPVLS Sbjct: 40 KPHLKAGFTLRCFQRLSVPNVATQLYPWQDNWYTSGSSTPVLS 82 Score = 26.2 bits (56), Expect(2) = 2e-09 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +3 Query: 9 QLVLVSSTPHSAYTPNLST 65 +LV VSS PH + TP LST Sbjct: 8 RLVPVSSKPHGSSTPGLST 26 >ref|WP_006805144.1| hypothetical protein [Leptotrichia hofstadii] gi|260859524|gb|EEX74024.1| hypothetical protein GCWU000323_01831 [Leptotrichia hofstadii F0254] Length = 48 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +1 Query: 112 SHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 +HL+A FPLRCFQRLS+P++ T+ CHWRDN RG S PVLS Sbjct: 6 THLKAGFPLRCFQRLSVPDVTTQPCHWRDNWYIRGLSNPVLS 47 >gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +1 Query: 109 RSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTPVLS 237 R+ + FPLRCFQRLS P +AT QC WR NR+TRG+STPVLS Sbjct: 82 RTRFQVGFPLRCFQRLSRPYVATLQCGWRHNRSTRGTSTPVLS 124 >ref|WP_007385104.1| conserved hypothetical protein, partial [Streptomyces sviceus] gi|297148196|gb|EFH28880.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 70 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +1 Query: 115 HLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSSTP 228 HLEA FPLRCFQRLSLPN+A + C W+DN +TRGSS P Sbjct: 33 HLEAGFPLRCFQRLSLPNVANQPCPWQDNWHTRGSSVP 70 >ref|WP_009068222.1| conserved hypothetical protein, partial [Streptomyces sp. SPB78] gi|302430314|gb|EFL02130.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces sp. SPB78] Length = 68 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/63 (52%), Positives = 41/63 (65%) Frame = +1 Query: 34 LTALTHPTYQRRSLRRPFRELKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTR 213 LT L +P YQ L + +HLEA FPLRCFQRLSLPN+A + C W++N +TR Sbjct: 7 LTGLPYPAYQPSRLLGALPS-QGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTR 65 Query: 214 GSS 222 GSS Sbjct: 66 GSS 68 >ref|WP_008748712.1| hypothetical protein, partial [Streptomyces sp. SPB74] gi|295827601|gb|EDY46972.2| hypothetical protein SSBG_04935 [Streptomyces sp. SPB74] Length = 77 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +1 Query: 94 LKVPVRSHLEASFPLRCFQRLSLPNIATRQCHWRDNRNTRGSS 222 LK +HLEA FPLRCFQRLSLPN+A + C W++N +TRGSS Sbjct: 35 LKGGGNTHLEAGFPLRCFQRLSLPNVANQPCPWQNNWHTRGSS 77