BLASTX nr result
ID: Achyranthes23_contig00036934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036934 (204 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ01822.1| hypothetical protein PRUPE_ppa001270mg [Prunus pe... 59 5e-07 >gb|EMJ01822.1| hypothetical protein PRUPE_ppa001270mg [Prunus persica] Length = 867 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = +1 Query: 1 QASFLEPLEFRHHSRSPQASFLDPPELNLQRAHDDDCYERQSHSERSVDEHEQQ-FEWGN 177 Q+SFLEP EF H PQ+SF++PP+ R D+ YE + S+RS++E EQ+ +W N Sbjct: 775 QSSFLEPPEFGQHITQPQSSFIEPPD--FIRQPSDNYYE--NFSDRSLEEQEQEHLDWKN 830 Query: 178 YHKSDCTPY 204 YHK T Y Sbjct: 831 YHKLSRTTY 839