BLASTX nr result
ID: Achyranthes23_contig00036661
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036661 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422524.1| hypothetical protein CICLE_v10028158mg [Citr... 55 8e-06 >ref|XP_006422524.1| hypothetical protein CICLE_v10028158mg [Citrus clementina] gi|557524458|gb|ESR35764.1| hypothetical protein CICLE_v10028158mg [Citrus clementina] Length = 492 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/52 (42%), Positives = 37/52 (71%) Frame = +3 Query: 6 RPRQRRWMSHVTTSRELLLQLFSLENRLPSPDHSEENPSSRLDFLELFLSLN 161 +P+ RWM HV + +L++QLFSL+ R SP+H++EN ++ + L+L L+ N Sbjct: 430 KPKATRWMHHVLSPEDLMMQLFSLQRRRTSPEHNDENSAAGRELLQLILTFN 481