BLASTX nr result
ID: Achyranthes23_contig00036657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036657 (241 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281062.1| PREDICTED: uncharacterized protein LOC100257... 57 3e-06 ref|XP_006369178.1| hypothetical protein POPTR_0001s18200g [Popu... 55 1e-05 gb|EOY26774.1| Uncharacterized protein TCM_028732 [Theobroma cacao] 55 1e-05 ref|XP_002299700.1| hypothetical protein POPTR_0001s18200g [Popu... 55 1e-05 >ref|XP_002281062.1| PREDICTED: uncharacterized protein LOC100257802 [Vitis vinifera] gi|297738835|emb|CBI28080.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 110 MSFRPVLLRQMTRVLRSLVEQPTAMVTTLLYYSDLLPQNAALER 241 MS P++ R + R++ SLV QP A ++TLLYYSDLLPQN LER Sbjct: 71 MSLTPLMFRSLVRLVSSLVGQPAASISTLLYYSDLLPQNIVLER 114 >ref|XP_006369178.1| hypothetical protein POPTR_0001s18200g [Populus trichocarpa] gi|550347591|gb|ERP65747.1| hypothetical protein POPTR_0001s18200g [Populus trichocarpa] Length = 68 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 110 MSFRPVLLRQMTRVLRSLVEQPTAMVTTLLYYSDLLPQNAALER 241 MS P++ R + R++ +L+ QPTA VTTLLYYS+LLP+N LER Sbjct: 1 MSLLPLMFRSLVRLISALMSQPTASVTTLLYYSNLLPRNLNLER 44 >gb|EOY26774.1| Uncharacterized protein TCM_028732 [Theobroma cacao] Length = 68 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 110 MSFRPVLLRQMTRVLRSLVEQPTAMVTTLLYYSDLLPQNAALER 241 MS P+++R + R+L +LV P A VTTLLYYSDLLP+N LER Sbjct: 1 MSLMPLMVRPLARLLTALVAHPAASVTTLLYYSDLLPRNLDLER 44 >ref|XP_002299700.1| hypothetical protein POPTR_0001s18200g [Populus trichocarpa] gi|222846958|gb|EEE84505.1| hypothetical protein POPTR_0001s18200g [Populus trichocarpa] Length = 69 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 110 MSFRPVLLRQMTRVLRSLVEQPTAMVTTLLYYSDLLPQNAALER 241 MS P++ R + R++ +L+ QPTA VTTLLYYS+LLP+N LER Sbjct: 1 MSLLPLMFRSLVRLISALMSQPTASVTTLLYYSNLLPRNLNLER 44