BLASTX nr result
ID: Achyranthes23_contig00036642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036642 (194 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB99769.1| hypothetical protein L484_023300 [Morus notabilis] 84 2e-14 ref|XP_006352838.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_004245879.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_002278451.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_006485434.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|XP_006436751.1| hypothetical protein CICLE_v10033739mg [Citr... 79 6e-13 ref|XP_006385629.1| hypothetical protein POPTR_0003s08800g [Popu... 79 6e-13 gb|EMJ11528.1| hypothetical protein PRUPE_ppa002049mg [Prunus pe... 77 2e-12 ref|NP_199470.1| pentatricopeptide repeat-containing protein [Ar... 77 3e-12 ref|XP_002863397.1| pentatricopeptide repeat-containing protein ... 77 3e-12 ref|XP_006281680.1| hypothetical protein CARUB_v10027819mg [Caps... 76 5e-12 ref|XP_004300258.1| PREDICTED: pentatricopeptide repeat-containi... 76 5e-12 gb|EOY24047.1| Pentatricopeptide (PPR) repeat-containing protein... 75 7e-12 ref|XP_004148730.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_002519842.1| pentatricopeptide repeat-containing protein,... 73 3e-11 ref|XP_006600892.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003549976.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_003524052.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|EPS71054.1| hypothetical protein M569_03703 [Genlisea aurea] 65 7e-09 ref|XP_006847700.1| hypothetical protein AMTR_s00149p00067730 [A... 65 1e-08 >gb|EXB99769.1| hypothetical protein L484_023300 [Morus notabilis] Length = 710 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/63 (65%), Positives = 51/63 (80%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPL+ T L+ + +QQ L + P KSTWVNPT+PK SV+SLQRQKRSP SYNPQ+R Sbjct: 63 SEQLKPLTTTTLSNDQEQQNNTLLSKP-KSTWVNPTRPKRSVISLQRQKRSPHSYNPQVR 121 Query: 182 DLK 190 DL+ Sbjct: 122 DLR 124 >ref|XP_006352838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Solanum tuberosum] Length = 711 Score = 82.8 bits (203), Expect = 4e-14 Identities = 44/63 (69%), Positives = 51/63 (80%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLS TIL ++ Q + L+ KSTWVNPT+PKPSVLSLQRQKRS +SYNPQIR Sbjct: 69 SEQLKPLSNTIL-DDPPNQARILSKP--KSTWVNPTRPKPSVLSLQRQKRSSYSYNPQIR 125 Query: 182 DLK 190 DLK Sbjct: 126 DLK 128 >ref|XP_004245879.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Solanum lycopersicum] Length = 711 Score = 82.8 bits (203), Expect = 4e-14 Identities = 44/63 (69%), Positives = 51/63 (80%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLS TIL ++ Q + L+ KSTWVNPT+PKPSVLSLQRQKRS +SYNPQIR Sbjct: 69 SEQLKPLSNTIL-DDPPNQARILSKP--KSTWVNPTRPKPSVLSLQRQKRSSYSYNPQIR 125 Query: 182 DLK 190 DLK Sbjct: 126 DLK 128 >ref|XP_002278451.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic [Vitis vinifera] Length = 723 Score = 82.4 bits (202), Expect = 6e-14 Identities = 42/64 (65%), Positives = 48/64 (75%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLS TIL + Q ++ KSTW+NPTKPKPSVLSLQR KR +SYNPQIR Sbjct: 76 SEQLKPLSKTILTRDHSGQTHLVSKP--KSTWINPTKPKPSVLSLQRHKRHNYSYNPQIR 133 Query: 182 DLKL 193 DLKL Sbjct: 134 DLKL 137 >ref|XP_006485434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Citrus sinensis] Length = 730 Score = 79.0 bits (193), Expect = 6e-13 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLS+T L+ + L+ KSTWVNPTKP+ SVLSLQRQKRS +SYNP++R Sbjct: 85 SEQLKPLSSTTLSPTKNDRTPLLSKP--KSTWVNPTKPRRSVLSLQRQKRSTYSYNPRVR 142 Query: 182 DLKL 193 DLKL Sbjct: 143 DLKL 146 >ref|XP_006436751.1| hypothetical protein CICLE_v10033739mg [Citrus clementina] gi|557538947|gb|ESR49991.1| hypothetical protein CICLE_v10033739mg [Citrus clementina] Length = 692 Score = 79.0 bits (193), Expect = 6e-13 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLS+T L+ + L+ KSTWVNPTKP+ SVLSLQRQKRS +SYNP++R Sbjct: 65 SEQLKPLSSTTLSPTKNDRTPLLSKP--KSTWVNPTKPRRSVLSLQRQKRSTYSYNPRVR 122 Query: 182 DLKL 193 DLKL Sbjct: 123 DLKL 126 >ref|XP_006385629.1| hypothetical protein POPTR_0003s08800g [Populus trichocarpa] gi|550342759|gb|ERP63426.1| hypothetical protein POPTR_0003s08800g [Populus trichocarpa] Length = 721 Score = 79.0 bits (193), Expect = 6e-13 Identities = 43/64 (67%), Positives = 50/64 (78%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 SDQLKPLSAT L+ + Q L+ KSTWVNPT+PK SVLSLQRQK+S +SYNPQIR Sbjct: 72 SDQLKPLSATTLSTKD-HKAQLLSKP--KSTWVNPTRPKRSVLSLQRQKKSLYSYNPQIR 128 Query: 182 DLKL 193 +LKL Sbjct: 129 ELKL 132 >gb|EMJ11528.1| hypothetical protein PRUPE_ppa002049mg [Prunus persica] Length = 724 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QL+PL++T L+ K Q Q L+ KS WVNP KPK SVLSLQRQKRS +SYNPQ+R Sbjct: 77 SEQLQPLTSTTLSNPPKDQSQLLSKP--KSIWVNPAKPKRSVLSLQRQKRSLYSYNPQVR 134 Query: 182 DLK 190 DL+ Sbjct: 135 DLR 137 >ref|NP_199470.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180372|sp|Q9LS25.1|PP420_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g46580, chloroplastic; Flags: Precursor gi|8885599|dbj|BAA97529.1| unnamed protein product [Arabidopsis thaliana] gi|332008017|gb|AED95400.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 711 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/63 (65%), Positives = 49/63 (77%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLSAT L + +Q Q L+ KS WVNPT+PK SVLSLQRQKRS +SYNPQI+ Sbjct: 66 SEQLKPLSATTLRQ---EQTQILSKP--KSVWVNPTRPKRSVLSLQRQKRSAYSYNPQIK 120 Query: 182 DLK 190 DL+ Sbjct: 121 DLR 123 >ref|XP_002863397.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309232|gb|EFH39656.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 711 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/63 (65%), Positives = 49/63 (77%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLSAT L + +Q Q L+ KS WVNPT+PK SVLSLQRQKRS +SYNPQI+ Sbjct: 66 SEQLKPLSATTLRQ---EQTQILSKP--KSVWVNPTRPKRSVLSLQRQKRSAYSYNPQIK 120 Query: 182 DLK 190 DL+ Sbjct: 121 DLR 123 >ref|XP_006281680.1| hypothetical protein CARUB_v10027819mg [Capsella rubella] gi|482550384|gb|EOA14578.1| hypothetical protein CARUB_v10027819mg [Capsella rubella] Length = 715 Score = 75.9 bits (185), Expect = 5e-12 Identities = 41/63 (65%), Positives = 48/63 (76%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLKPLSAT L E +Q L+ KS WVNPT+PK SVLSLQRQKRS +SYNPQI+ Sbjct: 71 SEQLKPLSATTLRE---EQTHILSKP--KSVWVNPTRPKRSVLSLQRQKRSAYSYNPQIK 125 Query: 182 DLK 190 DL+ Sbjct: 126 DLR 128 >ref|XP_004300258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 716 Score = 75.9 bits (185), Expect = 5e-12 Identities = 42/64 (65%), Positives = 47/64 (73%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 SDQLKPL+ T L K Q Q L+ KS WVNP KPK SVLSLQRQKRS +SYNPQ+R Sbjct: 73 SDQLKPLTTTTLPP--KDQPQVLSKP--KSIWVNPAKPKRSVLSLQRQKRSLYSYNPQVR 128 Query: 182 DLKL 193 DL+L Sbjct: 129 DLRL 132 >gb|EOY24047.1| Pentatricopeptide (PPR) repeat-containing protein [Theobroma cacao] Length = 711 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QL+PLS T L + K Q L+ KSTWVNPTKPK SVLSLQRQ RSP++YNP++R Sbjct: 66 SEQLQPLSTTTLPK--KDQACLLSKP--KSTWVNPTKPKRSVLSLQRQTRSPYAYNPKVR 121 Query: 182 DLKL 193 +LKL Sbjct: 122 ELKL 125 >ref|XP_004148730.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Cucumis sativus] gi|449521148|ref|XP_004167592.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Cucumis sativus] Length = 710 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 S+QLK LS T L+ + + L+ KSTWVNPTKPK SVLSLQRQKRS +SYNP++R Sbjct: 62 SEQLKNLSTTTLSNAPNDETRLLSKP--KSTWVNPTKPKRSVLSLQRQKRSSYSYNPKMR 119 Query: 182 DLK 190 DLK Sbjct: 120 DLK 122 >ref|XP_002519842.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540888|gb|EEF42446.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 677 Score = 73.2 bits (178), Expect = 3e-11 Identities = 40/66 (60%), Positives = 49/66 (74%), Gaps = 2/66 (3%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQG--QFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQ 175 SDQLKPLS+T L+ L + PN STWVNPTKPK SVLSLQRQKRSP+S NP+ Sbjct: 72 SDQLKPLSSTTLSTTTTTTTTKHSLLSKPN-STWVNPTKPKRSVLSLQRQKRSPYSLNPK 130 Query: 176 IRDLKL 193 +++L+L Sbjct: 131 VKELRL 136 >ref|XP_006600892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like isoform X2 [Glycine max] Length = 655 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 SDQL PL+ L+ + Q L+ KSTWVNPTK K SVLS +RQKR+ +SY+PQ+R Sbjct: 67 SDQLAPLANKTLSSATRDQSYALSKP--KSTWVNPTKAKRSVLSSERQKRATYSYSPQLR 124 Query: 182 DLK 190 DLK Sbjct: 125 DLK 127 >ref|XP_003549976.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like isoform X1 [Glycine max] Length = 714 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 SDQL PL+ L+ + Q L+ KSTWVNPTK K SVLS +RQKR+ +SY+PQ+R Sbjct: 67 SDQLAPLANKTLSSATRDQSYALSKP--KSTWVNPTKAKRSVLSSERQKRATYSYSPQLR 124 Query: 182 DLK 190 DLK Sbjct: 125 DLK 127 >ref|XP_003524052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46580, chloroplastic-like [Glycine max] Length = 712 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQIR 181 SDQL PL+ L+ + Q L+ KSTWVNPTK K SVLS +RQKR+ +SY+PQ+R Sbjct: 67 SDQLAPLANKTLSSATRDQSYALSKP--KSTWVNPTKAKRSVLSSERQKRATYSYSPQLR 124 Query: 182 DLK 190 DLK Sbjct: 125 DLK 127 >gb|EPS71054.1| hypothetical protein M569_03703 [Genlisea aurea] Length = 707 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/64 (54%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +2 Query: 2 SDQLKPLSATILAENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFS-YNPQI 178 ++QLKPLS IL+ T KSTW+NPT+P+PSVLS QRQKR FS Y+P+I Sbjct: 64 AEQLKPLSDVILSVEADASSTL--TTKPKSTWINPTRPRPSVLSPQRQKRPSFSAYSPKI 121 Query: 179 RDLK 190 RDL+ Sbjct: 122 RDLR 125 >ref|XP_006847700.1| hypothetical protein AMTR_s00149p00067730 [Amborella trichopoda] gi|548850969|gb|ERN09281.1| hypothetical protein AMTR_s00149p00067730 [Amborella trichopoda] Length = 151 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +2 Query: 2 SDQLKPLSATIL-AENGKQQGQFLNNTPNKSTWVNPTKPKPSVLSLQRQKRSPFSYNPQI 178 S+QLKPLS + L A+N Q KSTWVNPT+P+PSVLSLQR KR +++NP + Sbjct: 59 SEQLKPLSESFLSAKNPSPQSV----RKPKSTWVNPTRPRPSVLSLQRHKRPGYTWNPHL 114 Query: 179 RDLKL 193 ++L+L Sbjct: 115 KELRL 119