BLASTX nr result
ID: Achyranthes23_contig00036427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036427 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318735.1| nodulin family protein [Populus trichocarpa]... 57 3e-06 ref|XP_006852795.1| hypothetical protein AMTR_s00033p00156600 [A... 55 7e-06 >ref|XP_002318735.1| nodulin family protein [Populus trichocarpa] gi|222859408|gb|EEE96955.1| nodulin family protein [Populus trichocarpa] Length = 591 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 3 IRYVEGHRQKRSSDNFSFLFIYGVCLLLVAYLTSSLFLEDL 125 +R V GHRQ RSSDN SFLF Y VCL+L AYL L +EDL Sbjct: 197 VRPVRGHRQARSSDNSSFLFTYSVCLVLAAYLLGVLIVEDL 237 >ref|XP_006852795.1| hypothetical protein AMTR_s00033p00156600 [Amborella trichopoda] gi|548856409|gb|ERN14262.1| hypothetical protein AMTR_s00033p00156600 [Amborella trichopoda] Length = 159 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +3 Query: 3 IRYVEGHRQKRSSDNFSFLFIYGVCLLLVAYLTSSLFLEDLS 128 +R V GHRQ ++SDN SF F+YGVCLLL AYL + +EDL+ Sbjct: 27 VRPVGGHRQVQTSDNSSFTFVYGVCLLLAAYLMGVMLVEDLT 68