BLASTX nr result
ID: Achyranthes23_contig00036400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036400 (539 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus... 107 2e-21 ref|XP_002300144.1| phosphoglycerate/bisphosphoglycerate mutase ... 103 2e-20 ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 ref|XP_003624481.1| Pentatricopeptide repeat-containing protein ... 101 1e-19 ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 emb|CBI21289.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|EMJ16478.1| hypothetical protein PRUPE_ppa004841mg [Prunus pe... 100 3e-19 ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containi... 99 5e-19 ref|XP_006468878.1| PREDICTED: pentatricopeptide repeat-containi... 99 6e-19 gb|EOY02924.1| Tetratricopeptide repeat (TPR)-like superfamily p... 99 6e-19 ref|XP_004159154.1| PREDICTED: uncharacterized protein LOC101226... 99 6e-19 ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212... 99 6e-19 ref|XP_004233581.1| PREDICTED: pentatricopeptide repeat-containi... 99 8e-19 ref|XP_004493063.1| PREDICTED: pentatricopeptide repeat-containi... 98 1e-18 ref|NP_001078212.1| pentatricopeptide repeat-containing protein ... 97 3e-18 dbj|BAF00431.1| hypothetical protein [Arabidopsis thaliana] 97 3e-18 gb|EXB62848.1| hypothetical protein L484_008698 [Morus notabilis] 96 5e-18 ref|XP_006290700.1| hypothetical protein CARUB_v10016795mg [Caps... 96 5e-18 >gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] Length = 669 Score = 107 bits (266), Expect = 2e-21 Identities = 45/50 (90%), Positives = 48/50 (96%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 IH+IKNLR+CGDCH+ IKLISKVVNREIVVRDSKRFHHFKDG CSCGDYW Sbjct: 620 IHIIKNLRICGDCHIAIKLISKVVNREIVVRDSKRFHHFKDGMCSCGDYW 669 >ref|XP_002300144.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] gi|222847402|gb|EEE84949.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] Length = 666 Score = 103 bits (258), Expect = 2e-20 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 IHVIKNLRVCGDCH VIKLISK+V+REI+VRD+KRFHHFKDG CSCGDYW Sbjct: 617 IHVIKNLRVCGDCHTVIKLISKIVSREIIVRDAKRFHHFKDGLCSCGDYW 666 >ref|XP_006338733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 619 Score = 103 bits (257), Expect = 3e-20 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I VIKNLR+CGDCH IKLISK+VNREIVVRD+KRFHHFKDGSCSCGDYW Sbjct: 570 IQVIKNLRICGDCHTTIKLISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 619 >ref|XP_006338732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 645 Score = 103 bits (257), Expect = 3e-20 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I VIKNLR+CGDCH IKLISK+VNREIVVRD+KRFHHFKDGSCSCGDYW Sbjct: 596 IQVIKNLRICGDCHTTIKLISKIVNREIVVRDAKRFHHFKDGSCSCGDYW 645 >ref|XP_003624481.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240699|gb|ABD32557.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355499496|gb|AES80699.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 672 Score = 101 bits (251), Expect = 1e-19 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLR+CGDCH IKLISK+VNREIV+RDSKRFHHFKDG CSCGDYW Sbjct: 623 IQIIKNLRICGDCHFAIKLISKIVNREIVIRDSKRFHHFKDGLCSCGDYW 672 >ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Length = 735 Score = 100 bits (250), Expect = 2e-19 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 IH+IKNLRVCGDCH IK ISK+V+REIVVRDSKRFHHF+DG CSCGDYW Sbjct: 686 IHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 735 >emb|CBI21289.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 100 bits (250), Expect = 2e-19 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 IH+IKNLRVCGDCH IK ISK+V+REIVVRDSKRFHHF+DG CSCGDYW Sbjct: 532 IHIIKNLRVCGDCHTAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 581 >ref|XP_006599001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Glycine max] Length = 653 Score = 100 bits (248), Expect = 3e-19 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLR+CGDCH IKLISK VNREIVVRDSKRFHHFKDG CSCGDYW Sbjct: 604 IQIIKNLRICGDCHSAIKLISKAVNREIVVRDSKRFHHFKDGLCSCGDYW 653 >gb|EMJ16478.1| hypothetical protein PRUPE_ppa004841mg [Prunus persica] Length = 489 Score = 100 bits (248), Expect = 3e-19 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLRVC DCH VIKL+SKVVNREIVVRDSKRFHHF+DG CSCGDYW Sbjct: 440 IQIIKNLRVCADCHTVIKLLSKVVNREIVVRDSKRFHHFRDGLCSCGDYW 489 >ref|XP_004306318.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 747 Score = 99.4 bits (246), Expect = 5e-19 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLRVC DCH VIKLISKV+NREIVVRDSKRFHHFKDG CSCGD+W Sbjct: 698 IQIIKNLRVCADCHTVIKLISKVMNREIVVRDSKRFHHFKDGLCSCGDFW 747 >ref|XP_006468878.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Citrus sinensis] Length = 662 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLRVCGDCH VI+LISKVV+REIVVRDSKRFH+FKDG CSCGDYW Sbjct: 613 IRIIKNLRVCGDCHTVIRLISKVVDREIVVRDSKRFHYFKDGLCSCGDYW 662 >gb|EOY02924.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 659 Score = 99.0 bits (245), Expect = 6e-19 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 IH+IKNLR+CGDCH +KLISK+V+R+IV RDSKRFHHFKDG CSCGDYW Sbjct: 610 IHIIKNLRICGDCHTFMKLISKIVDRQIVARDSKRFHHFKDGICSCGDYW 659 >ref|XP_004159154.1| PREDICTED: uncharacterized protein LOC101226880 [Cucumis sativus] Length = 1725 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I++IKNLRVCGDCH VIKLISK+V+R+ VVRDSKRFHHFKDG CSCGDYW Sbjct: 1676 INIIKNLRVCGDCHTVIKLISKLVHRDFVVRDSKRFHHFKDGVCSCGDYW 1725 >ref|XP_004145727.1| PREDICTED: uncharacterized protein LOC101212001 [Cucumis sativus] Length = 2598 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I++IKNLRVCGDCH VIKLISK+V+R+ VVRDSKRFHHFKDG CSCGDYW Sbjct: 2549 INIIKNLRVCGDCHTVIKLISKLVHRDFVVRDSKRFHHFKDGVCSCGDYW 2598 >ref|XP_004233581.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Solanum lycopersicum] Length = 642 Score = 98.6 bits (244), Expect = 8e-19 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I VIKNLR+CGDCH IK+I K+V+REIVVRD+KRFHHFKDGSCSCGDYW Sbjct: 593 IQVIKNLRICGDCHTTIKIIYKIVSREIVVRDAKRFHHFKDGSCSCGDYW 642 >ref|XP_004493063.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Cicer arietinum] Length = 663 Score = 98.2 bits (243), Expect = 1e-18 Identities = 39/50 (78%), Positives = 47/50 (94%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLR+CGDCH+ IKLISK+V+REIV+RDSKRFHHFK+G C+CGDYW Sbjct: 614 IQIIKNLRICGDCHIAIKLISKIVHREIVIRDSKRFHHFKEGVCTCGDYW 663 >ref|NP_001078212.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274431|sp|Q9LW32.1|PP258_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g26782, mitochondrial; Flags: Precursor gi|9279668|dbj|BAB01225.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332643694|gb|AEE77215.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 659 Score = 96.7 bits (239), Expect = 3e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 ++V+KNLRVC DCH VIKLISK+V+RE VVRD+KRFHHFKDG CSCGDYW Sbjct: 610 VNVVKNLRVCSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGGCSCGDYW 659 >dbj|BAF00431.1| hypothetical protein [Arabidopsis thaliana] Length = 659 Score = 96.7 bits (239), Expect = 3e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 ++V+KNLRVC DCH VIKLISK+V+RE VVRD+KRFHHFKDG CSCGDYW Sbjct: 610 VNVVKNLRVCSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGGCSCGDYW 659 >gb|EXB62848.1| hypothetical protein L484_008698 [Morus notabilis] Length = 671 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 I +IKNLRVCGDCH V+KLISKV NREIVVRD KRFHHFK G CSCGDYW Sbjct: 622 IQIIKNLRVCGDCHTVLKLISKVDNREIVVRDLKRFHHFKGGLCSCGDYW 671 >ref|XP_006290700.1| hypothetical protein CARUB_v10016795mg [Capsella rubella] gi|482559407|gb|EOA23598.1| hypothetical protein CARUB_v10016795mg [Capsella rubella] Length = 663 Score = 95.9 bits (237), Expect = 5e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 2 IHVIKNLRVCGDCHVVIKLISKVVNREIVVRDSKRFHHFKDGSCSCGDYW 151 ++V+KNLRVC DCH VIKLISK+V+RE VVRD+KRFHHFKDG CSCGDYW Sbjct: 614 VNVVKNLRVCSDCHNVIKLISKIVDREFVVRDAKRFHHFKDGFCSCGDYW 663