BLASTX nr result
ID: Achyranthes23_contig00036180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036180 (662 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866170.1| hypothetical protein ARALYDRAFT_495778 [Arab... 58 2e-06 ref|XP_002514112.1| hypothetical protein RCOM_1046930 [Ricinus c... 58 2e-06 >ref|XP_002866170.1| hypothetical protein ARALYDRAFT_495778 [Arabidopsis lyrata subsp. lyrata] gi|297312005|gb|EFH42429.1| hypothetical protein ARALYDRAFT_495778 [Arabidopsis lyrata subsp. lyrata] Length = 154 Score = 58.2 bits (139), Expect = 2e-06 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 7/92 (7%) Frame = +2 Query: 125 GFKVRFVSYPYLPCSPFECCTSFITINANDETCGSSFSPTDSSVMASL----LFSAAGDL 292 GFKVRF+ PY + + +ITIN N+E+CG SFS +DSSVMAS+ LF + Sbjct: 61 GFKVRFIDDPYAVPVVVQSSSGYITINVNEESCGPSFSDSDSSVMASVDASGLFGCCFEY 120 Query: 293 VKSREKHEFLEDFDCDVWDWN---WGHFLGED 379 + + ++WN FLGED Sbjct: 121 GGEKGGAWSTNEVRASEYEWNDDMLARFLGED 152 >ref|XP_002514112.1| hypothetical protein RCOM_1046930 [Ricinus communis] gi|223546568|gb|EEF48066.1| hypothetical protein RCOM_1046930 [Ricinus communis] Length = 199 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +2 Query: 134 VRFVSYPYLPCSPFECCTSFITINANDETCGSSFSPTDSSVMASLLFSAAGDLVKSREKH 313 V+F+ PY F+ C+S+ITIN N+ETCGSSFS +SSVMAS+ G K K Sbjct: 83 VKFIENPYSSPLVFQSCSSYITINGNEETCGSSFSDWESSVMASV--DMCGGFTKG-GKM 139 Query: 314 EFLEDFDCDVW 346 + ++ F+ W Sbjct: 140 DCIDGFELSDW 150