BLASTX nr result
ID: Achyranthes23_contig00036055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00036055 (399 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-l... 56 6e-06 ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citr... 56 6e-06 ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus c... 55 1e-05 >ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis] Length = 476 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 397 TFSTVRGAGHTAPEYRRPQCLAMIMKWFAMLPL 299 TF+TV+GAGHTAPEY+ +CL MI +WFAM PL Sbjct: 444 TFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 476 >ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citrus clementina] gi|557524714|gb|ESR36020.1| hypothetical protein CICLE_v10028349mg [Citrus clementina] Length = 476 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -3 Query: 397 TFSTVRGAGHTAPEYRRPQCLAMIMKWFAMLPL 299 TF+TV+GAGHTAPEY+ +CL MI +WFAM PL Sbjct: 444 TFATVKGAGHTAPEYKPKECLEMINRWFAMYPL 476 >ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538734|gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis] Length = 478 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 397 TFSTVRGAGHTAPEYRRPQCLAMIMKWFAMLPL 299 TF+TV+G GHTAPEY+ QCLAM+ +WFA+ PL Sbjct: 446 TFATVKGGGHTAPEYKPKQCLAMVDRWFAIYPL 478