BLASTX nr result
ID: Achyranthes23_contig00035673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035673 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237872.1| PREDICTED: uncharacterized protein LOC101267... 57 3e-06 ref|XP_006354037.1| PREDICTED: uncharacterized protein LOC102585... 55 7e-06 >ref|XP_004237872.1| PREDICTED: uncharacterized protein LOC101267803 [Solanum lycopersicum] Length = 412 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 399 RILPRYTLLQGLRDRKIITAKVSFSTAICTSEPIFLKKYVLPYKDEAPELCKAY-TC 232 R++PR +L+ L++++++ KVSFS A+ SEP+F K+VLPYKDE P L ++Y TC Sbjct: 354 RVIPRNQVLKVLKEKRLVQ-KVSFSRAMYISEPMFRSKFVLPYKDEIPNLYESYVTC 409 >ref|XP_006354037.1| PREDICTED: uncharacterized protein LOC102585626 isoform X1 [Solanum tuberosum] gi|565375018|ref|XP_006354038.1| PREDICTED: uncharacterized protein LOC102585626 isoform X2 [Solanum tuberosum] Length = 412 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/57 (49%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 399 RILPRYTLLQGLRDRKIITAKVSFSTAICTSEPIFLKKYVLPYKDEAPELCKAY-TC 232 R++PR +L+ L+++K+ KVSFS A+ SEP+F ++VLPYKDE P L ++Y TC Sbjct: 354 RVIPRNQVLKVLKEKKL-NQKVSFSRAMYISEPMFRSEFVLPYKDEIPNLYESYVTC 409