BLASTX nr result
ID: Achyranthes23_contig00035663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035663 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ20684.1| hypothetical protein PRUPE_ppa022097mg, partial [... 134 9e-30 ref|XP_006350309.1| PREDICTED: pentatricopeptide repeat-containi... 133 2e-29 ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containi... 133 2e-29 ref|XP_003612374.1| Pentatricopeptide repeat-containing protein ... 133 2e-29 emb|CBI30973.3| unnamed protein product [Vitis vinifera] 133 2e-29 ref|XP_006409291.1| hypothetical protein EUTSA_v10022597mg [Eutr... 130 1e-28 ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arab... 130 1e-28 gb|ESW30011.1| hypothetical protein PHAVU_002G117300g [Phaseolus... 130 2e-28 ref|XP_004512279.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 ref|XP_004247300.1| PREDICTED: pentatricopeptide repeat-containi... 129 3e-28 ref|XP_006573520.1| PREDICTED: pentatricopeptide repeat-containi... 129 5e-28 ref|XP_002307219.2| hypothetical protein POPTR_0005s10540g [Popu... 129 5e-28 ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containi... 129 5e-28 ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containi... 129 5e-28 ref|XP_002521729.1| pentatricopeptide repeat-containing protein,... 128 7e-28 ref|XP_006297198.1| hypothetical protein CARUB_v10013206mg [Caps... 125 6e-27 ref|XP_006467094.1| PREDICTED: pentatricopeptide repeat-containi... 122 4e-26 ref|XP_006425269.1| hypothetical protein CICLE_v10026953mg [Citr... 122 4e-26 ref|NP_671862.1| pentatricopeptide repeat-containing protein [Ar... 122 6e-26 gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arab... 122 6e-26 >gb|EMJ20684.1| hypothetical protein PRUPE_ppa022097mg, partial [Prunus persica] Length = 511 Score = 134 bits (338), Expect = 9e-30 Identities = 62/73 (84%), Positives = 67/73 (91%) Frame = +2 Query: 2 ECGVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIG 181 E GVQGDDYTFG LMKGLCLTNRIGDGFKL+Q MK+RG+TPNTV+YNTLLHALCKN K+G Sbjct: 74 ESGVQGDDYTFGILMKGLCLTNRIGDGFKLLQAMKSRGITPNTVVYNTLLHALCKNKKVG 133 Query: 182 RARSLMNEMVEPN 220 RARSLMNEM PN Sbjct: 134 RARSLMNEMEAPN 146 >ref|XP_006350309.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Solanum tuberosum] Length = 622 Score = 133 bits (335), Expect = 2e-29 Identities = 59/71 (83%), Positives = 68/71 (95%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+ GDDYT+G LMKGLCLTNRIGDGFKL+QVMKTRG+TPNTVIYNTL+HALCKNGK+GRA Sbjct: 165 GIHGDDYTYGILMKGLCLTNRIGDGFKLLQVMKTRGITPNTVIYNTLIHALCKNGKVGRA 224 Query: 188 RSLMNEMVEPN 220 RSLM ++VEP+ Sbjct: 225 RSLMRDLVEPS 235 >ref|XP_002274224.2| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Vitis vinifera] Length = 686 Score = 133 bits (335), Expect = 2e-29 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV GDDYTFG LMKGLCLTNRIGD FKL+QVMK+RG TPNTVIYNT++HALCKNGK+GRA Sbjct: 228 GVSGDDYTFGILMKGLCLTNRIGDAFKLLQVMKSRGKTPNTVIYNTMIHALCKNGKVGRA 287 Query: 188 RSLMNEMVEPN 220 RSLMNEMVEP+ Sbjct: 288 RSLMNEMVEPS 298 >ref|XP_003612374.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513709|gb|AES95332.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 620 Score = 133 bits (335), Expect = 2e-29 Identities = 60/73 (82%), Positives = 69/73 (94%) Frame = +2 Query: 2 ECGVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIG 181 E GV+GDDYTFG LMKGLCLTNRIG+GFKL+Q++K G+TPNTVIYNTLLHALC+NGK+G Sbjct: 170 ESGVRGDDYTFGILMKGLCLTNRIGEGFKLLQLIKNNGVTPNTVIYNTLLHALCRNGKVG 229 Query: 182 RARSLMNEMVEPN 220 RARSLMNEMV+PN Sbjct: 230 RARSLMNEMVDPN 242 >emb|CBI30973.3| unnamed protein product [Vitis vinifera] Length = 722 Score = 133 bits (335), Expect = 2e-29 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV GDDYTFG LMKGLCLTNRIGD FKL+QVMK+RG TPNTVIYNT++HALCKNGK+GRA Sbjct: 76 GVSGDDYTFGILMKGLCLTNRIGDAFKLLQVMKSRGKTPNTVIYNTMIHALCKNGKVGRA 135 Query: 188 RSLMNEMVEPN 220 RSLMNEMVEP+ Sbjct: 136 RSLMNEMVEPS 146 >ref|XP_006409291.1| hypothetical protein EUTSA_v10022597mg [Eutrema salsugineum] gi|557110453|gb|ESQ50744.1| hypothetical protein EUTSA_v10022597mg [Eutrema salsugineum] Length = 629 Score = 130 bits (328), Expect = 1e-28 Identities = 59/71 (83%), Positives = 68/71 (95%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+QGD+YT+G LMKGLCLTNRIGDGFKL+Q+MKTRG+TPNTVIYNTLL+ALCKN K+GRA Sbjct: 180 GIQGDEYTYGILMKGLCLTNRIGDGFKLLQIMKTRGVTPNTVIYNTLLYALCKNEKVGRA 239 Query: 188 RSLMNEMVEPN 220 RSLM+EM EPN Sbjct: 240 RSLMSEMKEPN 250 >ref|XP_002884065.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] gi|297329905|gb|EFH60324.1| hypothetical protein ARALYDRAFT_343373 [Arabidopsis lyrata subsp. lyrata] Length = 1056 Score = 130 bits (328), Expect = 1e-28 Identities = 58/71 (81%), Positives = 67/71 (94%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+QGD+YT+G LMKGLCLTNRIGDGFKL+Q+MKT G+ PNTV+YNTLLHALCKNGK+GRA Sbjct: 165 GIQGDEYTYGILMKGLCLTNRIGDGFKLLQIMKTCGVAPNTVVYNTLLHALCKNGKVGRA 224 Query: 188 RSLMNEMVEPN 220 RSLM+EM EPN Sbjct: 225 RSLMSEMKEPN 235 >gb|ESW30011.1| hypothetical protein PHAVU_002G117300g [Phaseolus vulgaris] Length = 626 Score = 130 bits (327), Expect = 2e-28 Identities = 57/71 (80%), Positives = 69/71 (97%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV+GDDYTFG LMKG+CLTNRIG+GFKL+Q++K+RG+TPNTV+YNTLLHALC+NGK+GRA Sbjct: 178 GVEGDDYTFGILMKGMCLTNRIGEGFKLLQLIKSRGVTPNTVVYNTLLHALCRNGKVGRA 237 Query: 188 RSLMNEMVEPN 220 RSLM+EM EPN Sbjct: 238 RSLMSEMEEPN 248 >ref|XP_004512279.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Cicer arietinum] Length = 623 Score = 129 bits (325), Expect = 3e-28 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = +2 Query: 2 ECGVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIG 181 E GVQGDDYTFG LMKGLCLTNRIG+GFKL+Q++K+ G+TPNTVIYNTLLHALC+NGKIG Sbjct: 172 ESGVQGDDYTFGILMKGLCLTNRIGEGFKLLQLIKSNGVTPNTVIYNTLLHALCRNGKIG 231 Query: 182 RARSLMNEMVEPN 220 RARSLMNEM N Sbjct: 232 RARSLMNEMANLN 244 >ref|XP_004247300.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Solanum lycopersicum] Length = 628 Score = 129 bits (325), Expect = 3e-28 Identities = 58/71 (81%), Positives = 67/71 (94%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+QGD YT+G LMKGLCLTNRIGDGFKL+QVMKT G+TPNTVIYNTL+HALCKNGK+GRA Sbjct: 171 GIQGDHYTYGILMKGLCLTNRIGDGFKLLQVMKTCGITPNTVIYNTLIHALCKNGKVGRA 230 Query: 188 RSLMNEMVEPN 220 RSLM ++VEP+ Sbjct: 231 RSLMRDLVEPS 241 >ref|XP_006573520.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like isoform X2 [Glycine max] Length = 507 Score = 129 bits (323), Expect = 5e-28 Identities = 56/71 (78%), Positives = 68/71 (95%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV+GDDYTFG LMKGLCLTNRIG+GFKL+Q++K+RG+ PNTV+YNTLLHALC+NGK+GRA Sbjct: 170 GVEGDDYTFGILMKGLCLTNRIGEGFKLLQLIKSRGVAPNTVVYNTLLHALCRNGKVGRA 229 Query: 188 RSLMNEMVEPN 220 R+LMNEM +PN Sbjct: 230 RNLMNEMEDPN 240 >ref|XP_002307219.2| hypothetical protein POPTR_0005s10540g [Populus trichocarpa] gi|550338572|gb|EEE94215.2| hypothetical protein POPTR_0005s10540g [Populus trichocarpa] Length = 532 Score = 129 bits (323), Expect = 5e-28 Identities = 58/71 (81%), Positives = 66/71 (92%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+QGDDYT+G LMKGLCLTNRIG+GFKL+QV+K+RGL PN VIYNTLLHALC NGK+GRA Sbjct: 76 GIQGDDYTYGILMKGLCLTNRIGEGFKLLQVIKSRGLKPNVVIYNTLLHALCNNGKVGRA 135 Query: 188 RSLMNEMVEPN 220 RSLMNE+ EPN Sbjct: 136 RSLMNEIKEPN 146 >ref|XP_004308566.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 612 Score = 129 bits (323), Expect = 5e-28 Identities = 57/71 (80%), Positives = 67/71 (94%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV+GDDYTFG LMKGLCLT+RIGDGFKL+Q +K+RG+ PNTV+YNTLLHALC+NGK+GRA Sbjct: 156 GVKGDDYTFGILMKGLCLTSRIGDGFKLLQAIKSRGVAPNTVVYNTLLHALCRNGKVGRA 215 Query: 188 RSLMNEMVEPN 220 RSLMNEM +PN Sbjct: 216 RSLMNEMEDPN 226 >ref|XP_003516519.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like isoform X1 [Glycine max] Length = 618 Score = 129 bits (323), Expect = 5e-28 Identities = 56/71 (78%), Positives = 68/71 (95%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GV+GDDYTFG LMKGLCLTNRIG+GFKL+Q++K+RG+ PNTV+YNTLLHALC+NGK+GRA Sbjct: 170 GVEGDDYTFGILMKGLCLTNRIGEGFKLLQLIKSRGVAPNTVVYNTLLHALCRNGKVGRA 229 Query: 188 RSLMNEMVEPN 220 R+LMNEM +PN Sbjct: 230 RNLMNEMEDPN 240 >ref|XP_002521729.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539120|gb|EEF40716.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 629 Score = 128 bits (322), Expect = 7e-28 Identities = 58/71 (81%), Positives = 66/71 (92%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GVQGDDYTF LMKGLCLTNRIGDGF+L+QVMK+RG+ PN V+YNTLLHALCKNGK+GRA Sbjct: 173 GVQGDDYTFAILMKGLCLTNRIGDGFRLLQVMKSRGVKPNAVVYNTLLHALCKNGKVGRA 232 Query: 188 RSLMNEMVEPN 220 RSLM+E+ EPN Sbjct: 233 RSLMDEIEEPN 243 >ref|XP_006297198.1| hypothetical protein CARUB_v10013206mg [Capsella rubella] gi|482565907|gb|EOA30096.1| hypothetical protein CARUB_v10013206mg [Capsella rubella] Length = 629 Score = 125 bits (314), Expect = 6e-27 Identities = 55/71 (77%), Positives = 65/71 (91%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+QGD+YT+G LMKGLCLTNRI D FKL+Q+MKT G+ PNTV+YNTLLHALCKNGK+GRA Sbjct: 180 GIQGDEYTYGILMKGLCLTNRIADAFKLLQIMKTSGVAPNTVVYNTLLHALCKNGKVGRA 239 Query: 188 RSLMNEMVEPN 220 RSLM+E+ EPN Sbjct: 240 RSLMSEVKEPN 250 >ref|XP_006467094.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17525, mitochondrial-like [Citrus sinensis] Length = 618 Score = 122 bits (307), Expect = 4e-26 Identities = 54/71 (76%), Positives = 65/71 (91%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GVQGDDYT+ LMKGLCLTNR+GDGFKL+ VMK+RG+ P++VIYNTL+H LCKNGK+GRA Sbjct: 169 GVQGDDYTYAILMKGLCLTNRVGDGFKLLHVMKSRGVKPSSVIYNTLIHLLCKNGKVGRA 228 Query: 188 RSLMNEMVEPN 220 RSLM++M EPN Sbjct: 229 RSLMSDMEEPN 239 >ref|XP_006425269.1| hypothetical protein CICLE_v10026953mg [Citrus clementina] gi|557527259|gb|ESR38509.1| hypothetical protein CICLE_v10026953mg [Citrus clementina] Length = 621 Score = 122 bits (307), Expect = 4e-26 Identities = 54/71 (76%), Positives = 65/71 (91%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 GVQGDDYT+ LMKGLCLTNR+GDGFKL+ VMK+RG+ P++VIYNTL+H LCKNGK+GRA Sbjct: 169 GVQGDDYTYAILMKGLCLTNRVGDGFKLLHVMKSRGVKPSSVIYNTLIHLLCKNGKVGRA 228 Query: 188 RSLMNEMVEPN 220 RSLM++M EPN Sbjct: 229 RSLMSDMEEPN 239 >ref|NP_671862.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546776|sp|Q84VG6.2|PP160_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17525, mitochondrial; Flags: Precursor gi|330251547|gb|AEC06641.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 626 Score = 122 bits (305), Expect = 6e-26 Identities = 55/71 (77%), Positives = 63/71 (88%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+ GD YT+G LMKGL LTNRIGDGFKL+Q+MKT G+ PN V+YNTLLHALCKNGK+GRA Sbjct: 177 GIHGDVYTYGILMKGLSLTNRIGDGFKLLQIMKTSGVAPNAVVYNTLLHALCKNGKVGRA 236 Query: 188 RSLMNEMVEPN 220 RSLM+EM EPN Sbjct: 237 RSLMSEMKEPN 247 >gb|AAO72718.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 532 Score = 122 bits (305), Expect = 6e-26 Identities = 55/71 (77%), Positives = 63/71 (88%) Frame = +2 Query: 8 GVQGDDYTFGTLMKGLCLTNRIGDGFKLIQVMKTRGLTPNTVIYNTLLHALCKNGKIGRA 187 G+ GD YT+G LMKGL LTNRIGDGFKL+Q+MKT G+ PN V+YNTLLHALCKNGK+GRA Sbjct: 76 GIHGDVYTYGILMKGLSLTNRIGDGFKLLQIMKTSGVAPNAVVYNTLLHALCKNGKVGRA 135 Query: 188 RSLMNEMVEPN 220 RSLM+EM EPN Sbjct: 136 RSLMSEMKEPN 146