BLASTX nr result
ID: Achyranthes23_contig00035606
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035606 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74719.1| hypothetical protein M569_00044, partial [Genlise... 70 4e-18 >gb|EPS74719.1| hypothetical protein M569_00044, partial [Genlisea aurea] Length = 75 Score = 70.1 bits (170), Expect(2) = 4e-18 Identities = 38/51 (74%), Positives = 40/51 (78%) Frame = -1 Query: 534 RSDQLVHQTPTQCHTFSRSERIQCPTTDSSRNCVIGAEPGIAVSGHPLLFT 382 RS QLVHQTPTQ HTFS S + C DSSRNCVIGAEPG+AV GHP LFT Sbjct: 1 RSAQLVHQTPTQRHTFS-SPKGSC-AHDSSRNCVIGAEPGMAVRGHPPLFT 49 Score = 47.4 bits (111), Expect(2) = 4e-18 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 380 VREALFNTLRKDVHRGQKDSVIG 312 VREALFNTLRKDVHRGQ DSVIG Sbjct: 50 VREALFNTLRKDVHRGQNDSVIG 72