BLASTX nr result
ID: Achyranthes23_contig00035507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035507 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFH96116.1| DREB [Salicornia bigelovii] 62 8e-08 >gb|AFH96116.1| DREB [Salicornia bigelovii] Length = 284 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/69 (46%), Positives = 50/69 (72%), Gaps = 6/69 (8%) Frame = -1 Query: 197 MATAIDSYKNTSKNPLLLNPITEDLTKKLEPI-----TTNPSIFYSSYPSNPNLYIFNQG 33 MA AID+Y +++ NPL+L+P++E+L + EP TNP +++S SN NLY+F+QG Sbjct: 1 MAAAIDTYSSSNNNPLVLDPLSEELKRAFEPFIPASPPTNPPLYHS---SNNNLYMFSQG 57 Query: 32 FNQ-LGISQ 9 F+Q +GI+Q Sbjct: 58 FDQNMGIAQ 66