BLASTX nr result
ID: Achyranthes23_contig00035265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035265 (235 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15765.3| unnamed protein product [Vitis vinifera] 79 8e-13 ref|XP_002280974.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 emb|CAN83162.1| hypothetical protein VITISV_022557 [Vitis vinifera] 74 3e-11 ref|XP_006366292.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 ref|XP_004241650.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002511082.1| pentatricopeptide repeat-containing protein,... 59 9e-07 ref|XP_004155710.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >emb|CBI15765.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/77 (44%), Positives = 53/77 (68%) Frame = -1 Query: 232 SSAISPFPPTTTTDPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTY 53 +++++ P +T D Q L C+L+ CK S + +T ++HAKI+KFG+G P L++ L+ TY Sbjct: 33 TNSLNSSPSSTIPDHQKLNCILEACKFSSDFRTAFQSHAKIIKFGYGTYPSLITSLVSTY 92 Query: 52 INCDSLDFARSLLDEIP 2 +CD LD A LLDE+P Sbjct: 93 AHCDCLDLAHQLLDEMP 109 >ref|XP_002280974.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Vitis vinifera] Length = 523 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/65 (49%), Positives = 46/65 (70%) Frame = -1 Query: 196 TDPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYINCDSLDFARSL 17 +D Q L C+L+ CK S + +T ++HAKI+KFG+G P L++ L+ TY +CD LD A L Sbjct: 18 SDHQKLNCILEACKFSSDFRTAFQSHAKIIKFGYGTYPSLITSLVSTYAHCDCLDLAHQL 77 Query: 16 LDEIP 2 LDE+P Sbjct: 78 LDEMP 82 >emb|CAN83162.1| hypothetical protein VITISV_022557 [Vitis vinifera] Length = 562 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -1 Query: 193 DPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYINCDSLDFARSLL 14 D Q L C+L+ CK S + +T ++HAKI+KFG+G P L++ L+ TY +CD LD A LL Sbjct: 58 DHQKLNCILEACKFSSDFRTAFQSHAKIIKFGYGTYPSLITSLVSTYAHCDCLDLAHQLL 117 Query: 13 DEIP 2 DE+P Sbjct: 118 DEMP 121 >ref|XP_006366292.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Solanum tuberosum] Length = 556 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/75 (41%), Positives = 45/75 (60%) Frame = -1 Query: 226 AISPFPPTTTTDPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYIN 47 ++SP + D L C+L+ CK S +T HA I+K G+G P L+S +++TY + Sbjct: 41 SLSPTESHYSQDYHRLLCILEACKVSPNLRTTAGAHANIIKLGYGMYPSLISLMVVTYAS 100 Query: 46 CDSLDFARSLLDEIP 2 CD L+ AR LL EIP Sbjct: 101 CDRLNLARQLLVEIP 115 >ref|XP_004241650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Solanum lycopersicum] Length = 554 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/75 (41%), Positives = 45/75 (60%) Frame = -1 Query: 226 AISPFPPTTTTDPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYIN 47 ++SP + D L C+L+ CK S +T HA I+K G+G P L+S +++TY + Sbjct: 39 SLSPTESHYSQDYHRLLCILEACKMSPNLRTTAGAHANIIKLGYGVYPSLISLMVVTYAS 98 Query: 46 CDSLDFARSLLDEIP 2 CD L+ AR LL EIP Sbjct: 99 CDRLNLARQLLVEIP 113 >ref|XP_002511082.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550197|gb|EEF51684.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 274 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/64 (37%), Positives = 43/64 (67%) Frame = -1 Query: 196 TDPQMLQCVLDDCKTSLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYINCDSLDFARSL 17 +D Q+ +L+ CK SL+ KT + THA+I++FG+G P L + L+ TY+ CD + A + Sbjct: 8 SDYQLFIHLLEACKLSLDLKTAIETHARIIRFGYGTYPSLAASLVSTYVKCDHFNLACEV 67 Query: 16 LDEI 5 ++++ Sbjct: 68 INQV 71 >ref|XP_004155710.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990-like [Cucumis sativus] Length = 376 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -1 Query: 217 PFPPTTTTDPQMLQCVLDDCKT-SLESKTVLRTHAKIVKFGFGRDPILVSRLLLTYINCD 41 P P+ + D Q L VL+ C+ + SKTV+ THA+I+KFG+G P L++ L+ TY Sbjct: 25 PAAPSNSKDYQSLYRVLEACRLFHMNSKTVIETHARIIKFGYGNYPTLIASLVSTYQRVG 84 Query: 40 SLDFARSLLD 11 L+ LLD Sbjct: 85 CLNRVHQLLD 94