BLASTX nr result
ID: Achyranthes23_contig00035231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035231 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466483.1| PREDICTED: uncharacterized protein LOC102610... 57 3e-06 ref|XP_006426062.1| hypothetical protein CICLE_v10026064mg [Citr... 57 3e-06 >ref|XP_006466483.1| PREDICTED: uncharacterized protein LOC102610114 [Citrus sinensis] Length = 328 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = -3 Query: 152 MPGDRHFNRIDIVDIRFLIGMKVGSQRAEKYFGLLDSFFSFKLGKSEFNK 3 MP DRHF R+DI++I+ I K+G+ +++KYF LL + S K+ KSEF++ Sbjct: 1 MPADRHFMRLDILEIKSHIERKLGAAKSDKYFSLLTRYLSLKISKSEFDR 50 >ref|XP_006426062.1| hypothetical protein CICLE_v10026064mg [Citrus clementina] gi|557528052|gb|ESR39302.1| hypothetical protein CICLE_v10026064mg [Citrus clementina] Length = 328 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/50 (48%), Positives = 37/50 (74%) Frame = -3 Query: 152 MPGDRHFNRIDIVDIRFLIGMKVGSQRAEKYFGLLDSFFSFKLGKSEFNK 3 MP DRHF R+DI++I+ I K+G+ +++KYF LL + S K+ KSEF++ Sbjct: 1 MPADRHFMRLDILEIKSHIERKLGAAKSDKYFSLLTRYLSLKISKSEFDR 50