BLASTX nr result
ID: Achyranthes23_contig00035201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035201 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331135.1| predicted protein [Populus trichocarpa] gi|5... 133 3e-29 gb|EMJ11348.1| hypothetical protein PRUPE_ppa024340mg [Prunus pe... 129 3e-28 emb|CBI35295.3| unnamed protein product [Vitis vinifera] 128 9e-28 ref|XP_002271266.1| PREDICTED: pentatricopeptide repeat-containi... 128 9e-28 ref|XP_006364114.1| PREDICTED: pentatricopeptide repeat-containi... 127 2e-27 ref|XP_004248199.1| PREDICTED: pentatricopeptide repeat-containi... 126 3e-27 emb|CAN61464.1| hypothetical protein VITISV_005683 [Vitis vinifera] 126 3e-27 ref|XP_006585975.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 gb|EPS61026.1| hypothetical protein M569_13774 [Genlisea aurea] 124 1e-26 ref|XP_004301227.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|XP_003631155.1| Pentatricopeptide repeat-containing protein ... 124 2e-26 gb|ESW32564.1| hypothetical protein PHAVU_002G332900g [Phaseolus... 120 2e-25 gb|AFW63848.1| hypothetical protein ZEAMMB73_561595 [Zea mays] 119 5e-25 gb|AFW63847.1| hypothetical protein ZEAMMB73_561595 [Zea mays] 119 5e-25 ref|XP_003567560.1| PREDICTED: pentatricopeptide repeat-containi... 118 7e-25 gb|AAL73981.1|AF466201_10 putative vegetative storage protein [S... 118 9e-25 ref|XP_004506659.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 gb|EMS54140.1| hypothetical protein TRIUR3_08732 [Triticum urartu] 117 2e-24 dbj|BAK05141.1| predicted protein [Hordeum vulgare subsp. vulgare] 116 3e-24 ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containi... 115 5e-24 >ref|XP_002331135.1| predicted protein [Populus trichocarpa] gi|566259938|ref|XP_006389523.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550312346|gb|ERP48437.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 799 Score = 133 bits (334), Expect = 3e-29 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 +LLYH EKLAIAF ++SLSP + I VTKNLRVCGDCH AIK+I+LVTKR+ITVRD SRFH Sbjct: 727 VLLYHSEKLAIAFGILSLSPDKHIIVTKNLRVCGDCHTAIKFISLVTKRDITVRDASRFH 786 Query: 186 HFKDGVCNCGDFW 224 HFKDG+CNCGDFW Sbjct: 787 HFKDGICNCGDFW 799 >gb|EMJ11348.1| hypothetical protein PRUPE_ppa024340mg [Prunus persica] Length = 840 Score = 129 bits (325), Expect = 3e-28 Identities = 57/73 (78%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLAIA+A++SL P +PI VTKNLRVCGDCH AIK ITL+TKREI VRD +RFH Sbjct: 768 ILLYHSEKLAIAYAILSLRPGKPILVTKNLRVCGDCHAAIKVITLITKREIIVRDLTRFH 827 Query: 186 HFKDGVCNCGDFW 224 HFKDG+CNC DFW Sbjct: 828 HFKDGICNCADFW 840 >emb|CBI35295.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 128 bits (321), Expect = 9e-28 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLAIAF +++L +PI VTKNLRVCGDCH AIK++TL+TKREITVRD +RFH Sbjct: 573 ILLYHSEKLAIAFGILNLKAGRPILVTKNLRVCGDCHTAIKFMTLITKREITVRDANRFH 632 Query: 186 HFKDGVCNCGDFW 224 HFK+G CNCGDFW Sbjct: 633 HFKNGTCNCGDFW 645 >ref|XP_002271266.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Vitis vinifera] Length = 785 Score = 128 bits (321), Expect = 9e-28 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLAIAF +++L +PI VTKNLRVCGDCH AIK++TL+TKREITVRD +RFH Sbjct: 713 ILLYHSEKLAIAFGILNLKAGRPILVTKNLRVCGDCHTAIKFMTLITKREITVRDANRFH 772 Query: 186 HFKDGVCNCGDFW 224 HFK+G CNCGDFW Sbjct: 773 HFKNGTCNCGDFW 785 >ref|XP_006364114.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Solanum tuberosum] Length = 804 Score = 127 bits (318), Expect = 2e-27 Identities = 54/73 (73%), Positives = 65/73 (89%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLA+AFA+++L PS+ I VTKNLRVC DCH +KYI+L+TKREITVRD SRFH Sbjct: 732 ILLYHSEKLAVAFALLNLDPSKSILVTKNLRVCVDCHSTLKYISLITKREITVRDASRFH 791 Query: 186 HFKDGVCNCGDFW 224 HF+DG+C+CGDFW Sbjct: 792 HFRDGICSCGDFW 804 >ref|XP_004248199.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Solanum lycopersicum] Length = 804 Score = 126 bits (317), Expect = 3e-27 Identities = 54/73 (73%), Positives = 65/73 (89%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLA+AFA+++L PS+ I VTKNLRVC DCH +KYI+L+TKREITVRD SRFH Sbjct: 732 ILLYHSEKLAVAFALLNLDPSKSILVTKNLRVCVDCHSTMKYISLITKREITVRDASRFH 791 Query: 186 HFKDGVCNCGDFW 224 HF+DG+C+CGDFW Sbjct: 792 HFRDGICSCGDFW 804 >emb|CAN61464.1| hypothetical protein VITISV_005683 [Vitis vinifera] Length = 785 Score = 126 bits (317), Expect = 3e-27 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLAIAF +++L +PI VTKNLRVCGDCH AIK++T++TKREITVRD +RFH Sbjct: 713 ILLYHSEKLAIAFGILNLKAGRPILVTKNLRVCGDCHAAIKFMTVITKREITVRDANRFH 772 Query: 186 HFKDGVCNCGDFW 224 HFK+G CNCGDFW Sbjct: 773 HFKNGTCNCGDFW 785 >ref|XP_006585975.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like isoform X1 [Glycine max] gi|571473624|ref|XP_006585976.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like isoform X2 [Glycine max] Length = 783 Score = 124 bits (312), Expect = 1e-26 Identities = 52/73 (71%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EK+AIAF +++ SPS PI VTKNLR+C DCH A+K++TL+TKREITVRD SRFH Sbjct: 711 ILLYHSEKIAIAFGILNTSPSNPILVTKNLRICVDCHTAVKFMTLITKREITVRDASRFH 770 Query: 186 HFKDGVCNCGDFW 224 HF++G+CNC DFW Sbjct: 771 HFENGICNCQDFW 783 >gb|EPS61026.1| hypothetical protein M569_13774 [Genlisea aurea] Length = 795 Score = 124 bits (312), Expect = 1e-26 Identities = 53/72 (73%), Positives = 64/72 (88%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLA+AF V+ + + I V+KNLRVCGDCH+AIKY+T++TKREI+VRDT+RFHH Sbjct: 724 LLYHGEKLAVAFGVLRVGGDKRIVVSKNLRVCGDCHEAIKYVTVITKREISVRDTTRFHH 783 Query: 189 FKDGVCNCGDFW 224 FKDGVCNCGDFW Sbjct: 784 FKDGVCNCGDFW 795 >ref|XP_004301227.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like [Fragaria vesca subsp. vesca] Length = 808 Score = 124 bits (311), Expect = 1e-26 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EKLAIA+ ++ LS +PIFVTKNLRVCGDCH AIK+I+LVTKREI++RD SRFH Sbjct: 736 ILLYHSEKLAIAYGILHLSQGKPIFVTKNLRVCGDCHAAIKFISLVTKREISIRDVSRFH 795 Query: 186 HFKDGVCNCGDFW 224 HF+DG C+C DFW Sbjct: 796 HFRDGNCSCADFW 808 >ref|XP_003631155.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355525177|gb|AET05631.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 785 Score = 124 bits (310), Expect = 2e-26 Identities = 54/73 (73%), Positives = 63/73 (86%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EK+AIAF +++ SPS I VTKNLR+C DCH AIK+ITL+T+REITVRD SRFH Sbjct: 713 ILLYHSEKVAIAFGILNTSPSSRILVTKNLRICVDCHSAIKFITLLTEREITVRDASRFH 772 Query: 186 HFKDGVCNCGDFW 224 HFKDG+CNC DFW Sbjct: 773 HFKDGICNCQDFW 785 >gb|ESW32564.1| hypothetical protein PHAVU_002G332900g [Phaseolus vulgaris] Length = 779 Score = 120 bits (301), Expect = 2e-25 Identities = 49/73 (67%), Positives = 64/73 (87%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EK+AIAF +++ PS PI VTKNLR+C DCH+A+K++TL+T+R+ITVRD SRFH Sbjct: 707 ILLYHSEKIAIAFGILNTRPSNPILVTKNLRICVDCHNAVKFMTLITERKITVRDASRFH 766 Query: 186 HFKDGVCNCGDFW 224 HF++G+CNC DFW Sbjct: 767 HFENGICNCRDFW 779 >gb|AFW63848.1| hypothetical protein ZEAMMB73_561595 [Zea mays] Length = 1174 Score = 119 bits (297), Expect = 5e-25 Identities = 56/81 (69%), Positives = 64/81 (79%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF V+SL+ + IFVTKNLRVCGDCH AIKY+TLV R I VRDT+RFHH Sbjct: 709 LLYHSEKLAIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDTNRFHH 768 Query: 189 FKDGVCNCGDFW*PCLSLAKI 251 FK+G C+CG+FW L L I Sbjct: 769 FKNGQCSCGNFWLSILLLMTI 789 >gb|AFW63847.1| hypothetical protein ZEAMMB73_561595 [Zea mays] Length = 1274 Score = 119 bits (297), Expect = 5e-25 Identities = 56/81 (69%), Positives = 64/81 (79%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF V+SL+ + IFVTKNLRVCGDCH AIKY+TLV R I VRDT+RFHH Sbjct: 709 LLYHSEKLAIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDTNRFHH 768 Query: 189 FKDGVCNCGDFW*PCLSLAKI 251 FK+G C+CG+FW L L I Sbjct: 769 FKNGQCSCGNFWLSILLLMTI 789 >ref|XP_003567560.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Brachypodium distachyon] Length = 808 Score = 118 bits (296), Expect = 7e-25 Identities = 53/72 (73%), Positives = 60/72 (83%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF V++LS + IFVTKNLRVCGDCH IKY+TLV KR I VRD +RFHH Sbjct: 737 LLYHSEKLAIAFGVLTLSEDKTIFVTKNLRVCGDCHTVIKYMTLVRKRAIIVRDANRFHH 796 Query: 189 FKDGVCNCGDFW 224 FK+G C+CGDFW Sbjct: 797 FKNGQCSCGDFW 808 >gb|AAL73981.1|AF466201_10 putative vegetative storage protein [Sorghum bicolor] Length = 779 Score = 118 bits (295), Expect = 9e-25 Identities = 53/72 (73%), Positives = 60/72 (83%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF V+SL+ + IFVTKNLRVCGDCH AIKY+TLV R I VRD +RFHH Sbjct: 708 LLYHSEKLAIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDANRFHH 767 Query: 189 FKDGVCNCGDFW 224 FK+G C+CGDFW Sbjct: 768 FKNGQCSCGDFW 779 >ref|XP_004506659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like isoform X1 [Cicer arietinum] Length = 781 Score = 117 bits (292), Expect = 2e-24 Identities = 49/73 (67%), Positives = 62/73 (84%) Frame = +3 Query: 6 ILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFH 185 ILLYH EK+AIAF +++ +P+ I VTKNLR+C DCH AIK+ITL+++REI VRD SRFH Sbjct: 709 ILLYHSEKIAIAFGILNTNPNNRILVTKNLRICVDCHSAIKFITLISEREIIVRDASRFH 768 Query: 186 HFKDGVCNCGDFW 224 HFK+G+CNC DFW Sbjct: 769 HFKNGICNCQDFW 781 >gb|EMS54140.1| hypothetical protein TRIUR3_08732 [Triticum urartu] Length = 635 Score = 117 bits (292), Expect = 2e-24 Identities = 51/72 (70%), Positives = 61/72 (84%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF V++LS + IFVTKNLRVCGDCH IKY++LV +R+I VRD +RFHH Sbjct: 564 LLYHSEKLAIAFGVLTLSEDKTIFVTKNLRVCGDCHTVIKYMSLVRRRDIIVRDANRFHH 623 Query: 189 FKDGVCNCGDFW 224 FK+G C+CGDFW Sbjct: 624 FKNGQCSCGDFW 635 >dbj|BAK05141.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 413 Score = 116 bits (291), Expect = 3e-24 Identities = 50/72 (69%), Positives = 61/72 (84%) Frame = +3 Query: 9 LLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRFHH 188 LLYH EKLAIAF +++LS + IFVTKNLRVCGDCH IKY++LV +R+I VRD +RFHH Sbjct: 342 LLYHSEKLAIAFGILTLSEDKDIFVTKNLRVCGDCHTVIKYMSLVRRRDIIVRDANRFHH 401 Query: 189 FKDGVCNCGDFW 224 FK+G C+CGDFW Sbjct: 402 FKNGQCSCGDFW 413 >ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 891 Score = 115 bits (289), Expect = 5e-24 Identities = 48/74 (64%), Positives = 61/74 (82%) Frame = +3 Query: 3 HILLYHREKLAIAFAVISLSPSQPIFVTKNLRVCGDCHDAIKYITLVTKREITVRDTSRF 182 HIL H E+LAIAF +IS P PI + KNLRVCGDCH+A K+I+ +T+REI VRD++RF Sbjct: 818 HILTSHSERLAIAFGIISTPPKSPIRIFKNLRVCGDCHNATKFISRITQREIVVRDSNRF 877 Query: 183 HHFKDGVCNCGDFW 224 HHFKDG+C+CGD+W Sbjct: 878 HHFKDGICSCGDYW 891