BLASTX nr result
ID: Achyranthes23_contig00035065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00035065 (692 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] 61 4e-07 >gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] Length = 161 Score = 60.8 bits (146), Expect = 4e-07 Identities = 32/60 (53%), Positives = 41/60 (68%) Frame = -3 Query: 561 KPTKRSPRSNKNKINNSGFPNTKPLKVVHISNPMKFTATPTEFRALVQGLTGRDAVFDWP 382 KPTK++ +NK K T+P+KVV+ISNPMK + +EFRALVQ LTG+DA F P Sbjct: 14 KPTKKTSANNKTK-------KTRPVKVVYISNPMKIKTSASEFRALVQELTGQDAEFPDP 66