BLASTX nr result
ID: Achyranthes23_contig00034998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034998 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355021.1| PREDICTED: putative Myb family transcription... 133 3e-29 ref|XP_006355020.1| PREDICTED: putative Myb family transcription... 133 3e-29 ref|XP_002281928.1| PREDICTED: uncharacterized protein LOC100262... 132 5e-29 emb|CAN63286.1| hypothetical protein VITISV_025194 [Vitis vinifera] 132 5e-29 ref|XP_002311560.1| predicted protein [Populus trichocarpa] 130 2e-28 ref|XP_002963490.1| hypothetical protein SELMODRAFT_438636 [Sela... 129 5e-28 ref|XP_002988200.1| hypothetical protein SELMODRAFT_426960 [Sela... 129 5e-28 ref|XP_002521884.1| conserved hypothetical protein [Ricinus comm... 128 7e-28 gb|EOY01219.1| Homeodomain-like superfamily protein, putative is... 128 9e-28 ref|XP_001762580.1| predicted protein [Physcomitrella patens] gi... 127 1e-27 ref|XP_006378423.1| hypothetical protein POPTR_0010s10990g [Popu... 125 6e-27 gb|ADL36778.1| MYBR domain class transcription factor [Malus dom... 125 6e-27 ref|XP_002315831.1| predicted protein [Populus trichocarpa] 125 6e-27 ref|XP_002273049.2| PREDICTED: uncharacterized protein LOC100263... 125 8e-27 emb|CBI25446.3| unnamed protein product [Vitis vinifera] 125 8e-27 ref|XP_006470870.1| PREDICTED: uncharacterized protein LOC102607... 124 1e-26 ref|XP_006420714.1| hypothetical protein CICLE_v100054661mg, par... 124 1e-26 ref|XP_006855580.1| hypothetical protein AMTR_s00044p00042560 [A... 124 1e-26 gb|EMJ23055.1| hypothetical protein PRUPE_ppa021540mg [Prunus pe... 124 1e-26 gb|EXB53945.1| Putative Myb family transcription factor [Morus n... 124 1e-26 >ref|XP_006355021.1| PREDICTED: putative Myb family transcription factor At1g14600-like isoform X2 [Solanum tuberosum] Length = 308 Score = 133 bits (334), Expect = 3e-29 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N VRQY+RSKVPRLRWTPDLH CF+HAIE+LG QDKATPKLVLQ+MDVRGLTISHVKSH Sbjct: 7 NGGVRQYIRSKVPRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISHVKSH 66 Query: 37 LQMFRSMKTDQN 2 LQM+RSMK+D N Sbjct: 67 LQMYRSMKSDVN 78 >ref|XP_006355020.1| PREDICTED: putative Myb family transcription factor At1g14600-like isoform X1 [Solanum tuberosum] Length = 309 Score = 133 bits (334), Expect = 3e-29 Identities = 61/72 (84%), Positives = 67/72 (93%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N VRQY+RSKVPRLRWTPDLH CF+HAIE+LG QDKATPKLVLQ+MDVRGLTISHVKSH Sbjct: 7 NGGVRQYIRSKVPRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISHVKSH 66 Query: 37 LQMFRSMKTDQN 2 LQM+RSMK+D N Sbjct: 67 LQMYRSMKSDVN 78 >ref|XP_002281928.1| PREDICTED: uncharacterized protein LOC100262842 [Vitis vinifera] gi|296081414|emb|CBI16847.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 132 bits (332), Expect = 5e-29 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N +VRQY+RSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQLMDVRGLTISHVKSH Sbjct: 7 NGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQLMDVRGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSMK+D Sbjct: 67 LQMYRSMKSD 76 >emb|CAN63286.1| hypothetical protein VITISV_025194 [Vitis vinifera] Length = 303 Score = 132 bits (332), Expect = 5e-29 Identities = 61/70 (87%), Positives = 67/70 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N +VRQY+RSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQLMDVRGLTISHVKSH Sbjct: 7 NGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQLMDVRGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSMK+D Sbjct: 67 LQMYRSMKSD 76 >ref|XP_002311560.1| predicted protein [Populus trichocarpa] Length = 78 Score = 130 bits (327), Expect = 2e-28 Identities = 60/70 (85%), Positives = 68/70 (97%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQYVRSKVPRLRWTP+LHRCF+HAIERLG QDKATPKLVLQLMDV+GLTISHVKSH Sbjct: 7 SGAVRQYVRSKVPRLRWTPELHRCFVHAIERLGGQDKATPKLVLQLMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSM++D Sbjct: 67 LQMYRSMRSD 76 >ref|XP_002963490.1| hypothetical protein SELMODRAFT_438636 [Selaginella moellendorffii] gi|300168758|gb|EFJ35361.1| hypothetical protein SELMODRAFT_438636 [Selaginella moellendorffii] Length = 427 Score = 129 bits (323), Expect = 5e-28 Identities = 62/91 (68%), Positives = 77/91 (84%), Gaps = 6/91 (6%) Frame = -1 Query: 256 SGKNNTTSIHQKNNNS------VRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPK 95 SGK+ +S + +++S VRQYVRSK+PRLRWTPDLH CF++A+ERLG QD+ATPK Sbjct: 55 SGKSCDSSSRKNSSSSAATAGGVRQYVRSKMPRLRWTPDLHHCFVNAVERLGGQDRATPK 114 Query: 94 LVLQLMDVRGLTISHVKSHLQMFRSMKTDQN 2 LVLQLMDV+GLTI+HVKSHLQM+RSMK D+N Sbjct: 115 LVLQLMDVKGLTIAHVKSHLQMYRSMKNDEN 145 >ref|XP_002988200.1| hypothetical protein SELMODRAFT_426960 [Selaginella moellendorffii] gi|300143932|gb|EFJ10619.1| hypothetical protein SELMODRAFT_426960 [Selaginella moellendorffii] Length = 424 Score = 129 bits (323), Expect = 5e-28 Identities = 62/91 (68%), Positives = 77/91 (84%), Gaps = 6/91 (6%) Frame = -1 Query: 256 SGKNNTTSIHQKNNNS------VRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPK 95 SGK+ +S + +++S VRQYVRSK+PRLRWTPDLH CF++A+ERLG QD+ATPK Sbjct: 55 SGKSCDSSSRKNSSSSAATAGGVRQYVRSKMPRLRWTPDLHHCFVNAVERLGGQDRATPK 114 Query: 94 LVLQLMDVRGLTISHVKSHLQMFRSMKTDQN 2 LVLQLMDV+GLTI+HVKSHLQM+RSMK D+N Sbjct: 115 LVLQLMDVKGLTIAHVKSHLQMYRSMKNDEN 145 >ref|XP_002521884.1| conserved hypothetical protein [Ricinus communis] gi|223538922|gb|EEF40520.1| conserved hypothetical protein [Ricinus communis] Length = 298 Score = 128 bits (322), Expect = 7e-28 Identities = 59/70 (84%), Positives = 67/70 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQYVRSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQLMDV+GLTISHVKSH Sbjct: 7 SGTVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQLMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSM++D Sbjct: 67 LQMYRSMRSD 76 >gb|EOY01219.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 313 Score = 128 bits (321), Expect = 9e-28 Identities = 58/70 (82%), Positives = 67/70 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQY+RSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQLMDV+GLTISHVKSH Sbjct: 7 SGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQLMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSM++D Sbjct: 67 LQMYRSMRSD 76 >ref|XP_001762580.1| predicted protein [Physcomitrella patens] gi|162686313|gb|EDQ72703.1| predicted protein [Physcomitrella patens] Length = 585 Score = 127 bits (320), Expect = 1e-27 Identities = 58/74 (78%), Positives = 68/74 (91%) Frame = -1 Query: 223 KNNNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVK 44 K +VRQYVRSK+PRLRWTPDLH+CF+ A+ERLG QD+ATPKLVLQLMDV+GLTI+HVK Sbjct: 81 KTGGTVRQYVRSKMPRLRWTPDLHQCFVVAVERLGGQDRATPKLVLQLMDVKGLTIAHVK 140 Query: 43 SHLQMFRSMKTDQN 2 SHLQM+RSMK D+N Sbjct: 141 SHLQMYRSMKNDEN 154 >ref|XP_006378423.1| hypothetical protein POPTR_0010s10990g [Populus trichocarpa] gi|550329548|gb|ERP56220.1| hypothetical protein POPTR_0010s10990g [Populus trichocarpa] Length = 185 Score = 125 bits (314), Expect = 6e-27 Identities = 57/69 (82%), Positives = 66/69 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQYVRSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQ+MDV+GLTISHVKSH Sbjct: 7 SGAVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQMMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKT 11 LQM+RSM++ Sbjct: 67 LQMYRSMRS 75 >gb|ADL36778.1| MYBR domain class transcription factor [Malus domestica] Length = 281 Score = 125 bits (314), Expect = 6e-27 Identities = 61/76 (80%), Positives = 65/76 (85%) Frame = -1 Query: 241 TTSIHQKNNNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGL 62 TTS N +VRQYVRSKVPRLRWTP+LHRCFL AIERLG KATPKLVLQ MDV+GL Sbjct: 2 TTSSCSARNGAVRQYVRSKVPRLRWTPELHRCFLQAIERLGGHRKATPKLVLQFMDVKGL 61 Query: 61 TISHVKSHLQMFRSMK 14 TISHVKSHLQM+RSMK Sbjct: 62 TISHVKSHLQMYRSMK 77 >ref|XP_002315831.1| predicted protein [Populus trichocarpa] Length = 207 Score = 125 bits (314), Expect = 6e-27 Identities = 57/69 (82%), Positives = 66/69 (95%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQYVRSKVPRLRWTP+LH CF+HAIERLG QDKATPKLVLQ+MDV+GLTISHVKSH Sbjct: 7 SGAVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKLVLQMMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKT 11 LQM+RSM++ Sbjct: 67 LQMYRSMRS 75 >ref|XP_002273049.2| PREDICTED: uncharacterized protein LOC100263821 [Vitis vinifera] Length = 376 Score = 125 bits (313), Expect = 8e-27 Identities = 60/85 (70%), Positives = 71/85 (83%), Gaps = 2/85 (2%) Frame = -1 Query: 256 SGKNNTT--SIHQKNNNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQ 83 S N+T S + + SVR+YVRSK+PRLRWTPDLH CFLHA+ERLG QD+ATPKLVLQ Sbjct: 44 SSSNSTVEESERKAGSGSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRATPKLVLQ 103 Query: 82 LMDVRGLTISHVKSHLQMFRSMKTD 8 LMD++GL+ISHVKSHLQM+RS K D Sbjct: 104 LMDIKGLSISHVKSHLQMYRSKKID 128 >emb|CBI25446.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 125 bits (313), Expect = 8e-27 Identities = 60/85 (70%), Positives = 71/85 (83%), Gaps = 2/85 (2%) Frame = -1 Query: 256 SGKNNTT--SIHQKNNNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQ 83 S N+T S + + SVR+YVRSK+PRLRWTPDLH CFLHA+ERLG QD+ATPKLVLQ Sbjct: 137 SSSNSTVEESERKAGSGSVRRYVRSKMPRLRWTPDLHLCFLHAVERLGGQDRATPKLVLQ 196 Query: 82 LMDVRGLTISHVKSHLQMFRSMKTD 8 LMD++GL+ISHVKSHLQM+RS K D Sbjct: 197 LMDIKGLSISHVKSHLQMYRSKKID 221 >ref|XP_006470870.1| PREDICTED: uncharacterized protein LOC102607614 [Citrus sinensis] Length = 328 Score = 124 bits (312), Expect = 1e-26 Identities = 56/70 (80%), Positives = 66/70 (94%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQY+RSKVPRLRWTP+LHRCF+HAI+RLG KATPKLVLQLMDV+GLTISHVKSH Sbjct: 7 SGAVRQYIRSKVPRLRWTPELHRCFVHAIDRLGGHQKATPKLVLQLMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSM++D Sbjct: 67 LQMYRSMRSD 76 >ref|XP_006420714.1| hypothetical protein CICLE_v100054661mg, partial [Citrus clementina] gi|557522587|gb|ESR33954.1| hypothetical protein CICLE_v100054661mg, partial [Citrus clementina] Length = 238 Score = 124 bits (312), Expect = 1e-26 Identities = 56/70 (80%), Positives = 66/70 (94%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 + +VRQY+RSKVPRLRWTP+LHRCF+HAI+RLG KATPKLVLQLMDV+GLTISHVKSH Sbjct: 7 SGAVRQYIRSKVPRLRWTPELHRCFVHAIDRLGGHQKATPKLVLQLMDVKGLTISHVKSH 66 Query: 37 LQMFRSMKTD 8 LQM+RSM++D Sbjct: 67 LQMYRSMRSD 76 >ref|XP_006855580.1| hypothetical protein AMTR_s00044p00042560 [Amborella trichopoda] gi|548859367|gb|ERN17047.1| hypothetical protein AMTR_s00044p00042560 [Amborella trichopoda] Length = 336 Score = 124 bits (312), Expect = 1e-26 Identities = 56/72 (77%), Positives = 66/72 (91%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N +VRQY+RSK+PRLRWTP+LH F+HAI++LG QDKATPKLVLQLMDVRGLTISHVKSH Sbjct: 7 NGAVRQYIRSKIPRLRWTPELHHSFVHAIQKLGGQDKATPKLVLQLMDVRGLTISHVKSH 66 Query: 37 LQMFRSMKTDQN 2 LQM+R MK+D + Sbjct: 67 LQMYRGMKSDSS 78 >gb|EMJ23055.1| hypothetical protein PRUPE_ppa021540mg [Prunus persica] Length = 291 Score = 124 bits (312), Expect = 1e-26 Identities = 58/70 (82%), Positives = 64/70 (91%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N +VRQYVRSKVPRLRWTP+LH CFLH+IERLG KATPKLVLQLMDV+GLTISHVKSH Sbjct: 8 NGAVRQYVRSKVPRLRWTPELHHCFLHSIERLGGHKKATPKLVLQLMDVKGLTISHVKSH 67 Query: 37 LQMFRSMKTD 8 LQM+RSM+ D Sbjct: 68 LQMYRSMRGD 77 >gb|EXB53945.1| Putative Myb family transcription factor [Morus notabilis] Length = 339 Score = 124 bits (311), Expect = 1e-26 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -1 Query: 217 NNSVRQYVRSKVPRLRWTPDLHRCFLHAIERLGSQDKATPKLVLQLMDVRGLTISHVKSH 38 N +VRQY+RSKVPRLRWTP+LH CF+HAIERLG KATPKLVLQLMDV+GLTISHVKSH Sbjct: 8 NGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGHKKATPKLVLQLMDVKGLTISHVKSH 67 Query: 37 LQMFRSMKTD 8 LQM+RSM+ D Sbjct: 68 LQMYRSMRGD 77