BLASTX nr result
ID: Achyranthes23_contig00034710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034710 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD83300.1| Fgenesh protein 118 [Beta vulgaris] 55 6e-07 >gb|ABD83300.1| Fgenesh protein 118 [Beta vulgaris] Length = 322 Score = 54.7 bits (130), Expect(2) = 6e-07 Identities = 24/68 (35%), Positives = 38/68 (55%) Frame = -1 Query: 315 QVLPSFWRICSVIEETTNDWEEKLAVAEILAC*SVKRLNLGRITLKMKERTQKLLEEEPV 136 +++P FW+IC IE T DW A+ ++L S+K +N ++TLK K + +E Sbjct: 68 ELMPGFWKICFTIESATRDWSPPFALEDLLTLYSLKIINPNKVTLKQKPKYPIPVEGTGA 127 Query: 135 SDRGWKAR 112 S+ WK R Sbjct: 128 SESFWKTR 135 Score = 24.3 bits (51), Expect(2) = 6e-07 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 112 VKKSSLGKEGQWLKDGWSITGTS 44 V K SLG+ G L GW G+S Sbjct: 139 VAKDSLGEAGVLLHSGWPAGGSS 161