BLASTX nr result
ID: Achyranthes23_contig00034684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034684 (247 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362046.1| PREDICTED: uncharacterized protein LOC102594... 59 5e-07 gb|EMS68222.1| hypothetical protein TRIUR3_32602 [Triticum urartu] 58 1e-06 gb|EMT20271.1| hypothetical protein F775_29015 [Aegilops tauschii] 57 2e-06 gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] 57 3e-06 gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus... 57 3e-06 ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citr... 57 3e-06 ref|XP_004972816.1| PREDICTED: U6 snRNA-associated Sm-like prote... 57 3e-06 gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] 57 3e-06 ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like prote... 57 3e-06 ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containin... 57 3e-06 ref|XP_006305805.1| hypothetical protein CARUB_v10010754mg [Caps... 57 3e-06 ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like prote... 57 3e-06 dbj|BAC99422.1| putative snRNP core protein SMX5d [Oryza sativa ... 57 3e-06 gb|AFK37214.1| unknown [Medicago truncatula] 57 3e-06 ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 57 3e-06 emb|CBI32330.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Me... 57 3e-06 ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus ... 57 3e-06 gb|EEC82919.1| hypothetical protein OsI_27848 [Oryza sativa Indi... 57 3e-06 ref|NP_001152698.1| snRNP core Sm protein Sm-X5-like protein [Ze... 57 3e-06 >ref|XP_006362046.1| PREDICTED: uncharacterized protein LOC102594732 [Solanum tuberosum] Length = 123 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMVCSTFFPSLCCDEIVVFC 147 IRGTL SVDQYLNIKLENTRV D+D Y HMV F+ C +++FC Sbjct: 76 IRGTLHSVDQYLNIKLENTRVVDEDKYLHMVI-PFYSLSCVFVLLIFC 122 >gb|EMS68222.1| hypothetical protein TRIUR3_32602 [Triticum urartu] Length = 55 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHMV Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHMV 55 >gb|EMT20271.1| hypothetical protein F775_29015 [Aegilops tauschii] Length = 79 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHMI 55 >gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] Length = 140 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 72 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 102 >gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] Length = 125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 57 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 87 >ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] gi|568852209|ref|XP_006479772.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Citrus sinensis] gi|557546399|gb|ESR57377.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55 >ref|XP_004972816.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like isoform X1 [Setaria italica] Length = 125 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 57 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 87 >gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 425 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 455 >ref|XP_004493646.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Cicer arietinum] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55 >ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Cicer arietinum] Length = 497 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 429 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 459 >ref|XP_006305805.1| hypothetical protein CARUB_v10010754mg [Capsella rubella] gi|567156028|ref|XP_006418245.1| hypothetical protein EUTSA_v10009199mg [Eutrema salsugineum] gi|482574516|gb|EOA38703.1| hypothetical protein CARUB_v10010754mg [Capsella rubella] gi|557096016|gb|ESQ36598.1| hypothetical protein EUTSA_v10009199mg [Eutrema salsugineum] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55 >ref|XP_004294156.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Fragaria vesca subsp. vesca] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55 >dbj|BAC99422.1| putative snRNP core protein SMX5d [Oryza sativa Japonica Group] Length = 288 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 220 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 250 >gb|AFK37214.1| unknown [Medicago truncatula] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDRYPHML 55 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 421 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 451 >emb|CBI32330.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 69 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 99 >ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|355500846|gb|AES82049.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|388519597|gb|AFK47860.1| unknown [Lotus japonicus] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55 >ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223535995|gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 432 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 462 >gb|EEC82919.1| hypothetical protein OsI_27848 [Oryza sativa Indica Group] Length = 120 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 52 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 82 >ref|NP_001152698.1| snRNP core Sm protein Sm-X5-like protein [Zea mays] gi|195659125|gb|ACG49030.1| snRNP core Sm protein Sm-X5-like protein [Zea mays] gi|413917383|gb|AFW57315.1| snRNP core Sm protein Sm-X5-like protein [Zea mays] Length = 93 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 4 IRGTLLSVDQYLNIKLENTRVFDKDNYPHMV 96 IRGTL SVDQYLNIKLENTRV D+D YPHM+ Sbjct: 25 IRGTLHSVDQYLNIKLENTRVVDQDKYPHML 55