BLASTX nr result
ID: Achyranthes23_contig00034544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034544 (342 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282244.1| PREDICTED: uncharacterized protein LOC100250... 84 2e-14 emb|CBI28217.3| unnamed protein product [Vitis vinifera] 67 3e-09 gb|EOY31112.1| Uncharacterized protein TCM_038116 [Theobroma cacao] 66 4e-09 ref|XP_006450882.1| hypothetical protein CICLE_v10008357mg [Citr... 57 2e-06 ref|XP_004242773.1| PREDICTED: uncharacterized protein LOC101245... 55 7e-06 ref|XP_002527188.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 >ref|XP_002282244.1| PREDICTED: uncharacterized protein LOC100250879 [Vitis vinifera] Length = 424 Score = 84.0 bits (206), Expect = 2e-14 Identities = 45/106 (42%), Positives = 61/106 (57%), Gaps = 3/106 (2%) Frame = -1 Query: 318 IESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTPVGWQGSLPCFSG-- 145 +E+N+ LN+GSVYPLYYGTH QN + G + P+ +N V VG P+G + P G Sbjct: 219 VETNTPLNFGSVYPLYYGTHFQNEESHLGFQMPETANANTVFVGAPIGTSIAEPSEMGII 278 Query: 144 TRNLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLG-PSDP 10 +NL + E +K+ D+ GK +CDLSLRLG SDP Sbjct: 279 LQNLFSSDGTENVLNKNAQENFRDTCGKEPVAECDLSLRLGLSSDP 324 >emb|CBI28217.3| unnamed protein product [Vitis vinifera] Length = 302 Score = 66.6 bits (161), Expect = 3e-09 Identities = 38/104 (36%), Positives = 50/104 (48%), Gaps = 1/104 (0%) Frame = -1 Query: 318 IESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTPVGWQGSLPCFSGTR 139 +E+N+ LN+GSVYPLYYGTH QN + G + P+ +N V VG P+G Sbjct: 219 VETNTPLNFGSVYPLYYGTHFQNEESHLGFQMPETANANTVFVGAPIG------------ 266 Query: 138 NLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLG-PSDP 10 S + E++CDLSLRLG SDP Sbjct: 267 ---------------------TSIAEPSEMECDLSLRLGLSSDP 289 >gb|EOY31112.1| Uncharacterized protein TCM_038116 [Theobroma cacao] Length = 407 Score = 66.2 bits (160), Expect = 4e-09 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 2/105 (1%) Frame = -1 Query: 318 IESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTPVGWQGSLPCFSGT- 142 +E+N+ N G VYPLYYG H QNV+ Q G +N N+IVG P+G + P G+ Sbjct: 208 METNTRPNLGQVYPLYYGIHYQNVESQTGSPVQENIASDNIIVGRPIGTSVAQPVEMGSL 267 Query: 141 RNLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLGP-SDP 10 +NL + + + + K+ +CDLSLRLG SDP Sbjct: 268 QNLFSSSDVDVGGKRIGQQDIRHTNEKSFGTECDLSLRLGLFSDP 312 >ref|XP_006450882.1| hypothetical protein CICLE_v10008357mg [Citrus clementina] gi|568843993|ref|XP_006475881.1| PREDICTED: uncharacterized protein LOC102614540 [Citrus sinensis] gi|557554108|gb|ESR64122.1| hypothetical protein CICLE_v10008357mg [Citrus clementina] Length = 430 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 5/108 (4%) Frame = -1 Query: 318 IESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTPVGWQ----GSLPCF 151 +++N L GSVYPLYYGT Q D + G +N N + VG P+G G + Sbjct: 221 VDANVQLKLGSVYPLYYGTRFQTEDTKLGSGISENVNSTTIFVGKPIGTSIPEPGEMGAL 280 Query: 150 SGTRNLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLGPS-DP 10 + + A P +K + ++ + + CDLSLRLG S DP Sbjct: 281 PRLYSCSGSDTASKPTTKPDF---LELQRRPHVTGCDLSLRLGLSGDP 325 >ref|XP_004242773.1| PREDICTED: uncharacterized protein LOC101245669 [Solanum lycopersicum] Length = 482 Score = 55.5 bits (132), Expect = 7e-06 Identities = 41/104 (39%), Positives = 52/104 (50%), Gaps = 4/104 (3%) Frame = -1 Query: 315 ESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTP----VGWQGSLPCFS 148 ES+S L+ GSVYPL+YGT +Q +R PQ+ NVIVG P + + CF Sbjct: 212 ESSSSLDVGSVYPLFYGTDLQPEVSPLVLREPQH----NVIVGKPIYPSIVEPAKISCFP 267 Query: 147 GTRNLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLGPS 16 +L P + K D + ELDCDLSLRLG S Sbjct: 268 ---SLFPSRRDDV-QEKSCQADFRDKTRRMPELDCDLSLRLGLS 307 >ref|XP_002527188.1| conserved hypothetical protein [Ricinus communis] gi|223533453|gb|EEF35201.1| conserved hypothetical protein [Ricinus communis] Length = 373 Score = 55.5 bits (132), Expect = 7e-06 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 1/99 (1%) Frame = -1 Query: 315 ESNSLLNYGSVYPLYYGTHIQNVDPQFGIRSPQNSNPRNVIVGTPVGWQGSLPC-FSGTR 139 E N LN GSVYPLYYG + P + P+ N + VGTP+ + P S Sbjct: 222 EINKQLNLGSVYPLYYGNNYHIKQPHLASQVPE-KNSNTIFVGTPISTSAAEPAEMSVFH 280 Query: 138 NLLPGENAETPASKDELVKSIDSRGKAVELDCDLSLRLG 22 + L +AE A + ++ K + CDLSLRLG Sbjct: 281 DFLTCPSAEISAKRISQADLGNTHEKPSGVQCDLSLRLG 319