BLASTX nr result
ID: Achyranthes23_contig00034504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034504 (812 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] 67 6e-09 ref|XP_002511914.1| hypothetical protein RCOM_1616500 [Ricinus c... 64 8e-08 ref|XP_004155883.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 61 4e-07 ref|XP_004134319.1| PREDICTED: uncharacterized protein LOC101210... 61 4e-07 emb|CBI40398.3| unnamed protein product [Vitis vinifera] 61 4e-07 ref|XP_004306740.1| PREDICTED: uncharacterized protein LOC101311... 61 5e-07 ref|XP_002320153.1| hypothetical protein POPTR_0014s08510g [Popu... 59 2e-06 gb|EMJ21489.1| hypothetical protein PRUPE_ppa000517mg [Prunus pe... 58 3e-06 ref|XP_006587834.1| PREDICTED: uncharacterized protein LOC100776... 57 8e-06 ref|XP_006587833.1| PREDICTED: uncharacterized protein LOC100776... 57 8e-06 ref|XP_006587832.1| PREDICTED: uncharacterized protein LOC100776... 57 8e-06 ref|XP_006587831.1| PREDICTED: uncharacterized protein LOC100776... 57 8e-06 ref|XP_003533596.1| PREDICTED: uncharacterized protein LOC100776... 57 8e-06 >gb|EXB51634.1| hypothetical protein L484_012927 [Morus notabilis] Length = 1056 Score = 67.4 bits (163), Expect = 6e-09 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 ET KK SYTRDFLLSLSEL+VCKKLP GFD SLLSEF+ AS Sbjct: 20 ETHKKLRISYTRDFLLSLSELDVCKKLPSGFDQSLLSEFEDAS 62 >ref|XP_002511914.1| hypothetical protein RCOM_1616500 [Ricinus communis] gi|223549094|gb|EEF50583.1| hypothetical protein RCOM_1616500 [Ricinus communis] Length = 1088 Score = 63.5 bits (153), Expect = 8e-08 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGA 4 E+ KK + SYTR+FLLSLSEL++CKKLP GFD S+LSEF+ A Sbjct: 22 ESQKKSIISYTREFLLSLSELDICKKLPSGFDQSILSEFEDA 63 >ref|XP_004155883.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101210153 [Cucumis sativus] Length = 1062 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 120 KKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 KKP SYTRDFLLSLS+L+VCKKLP FD S+++EF+ AS Sbjct: 23 KKPKFSYTRDFLLSLSDLDVCKKLPSSFDKSIIAEFEEAS 62 >ref|XP_004134319.1| PREDICTED: uncharacterized protein LOC101210153 [Cucumis sativus] Length = 1072 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 120 KKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 KKP SYTRDFLLSLS+L+VCKKLP FD S+++EF+ AS Sbjct: 23 KKPKFSYTRDFLLSLSDLDVCKKLPSSFDKSIIAEFEEAS 62 >emb|CBI40398.3| unnamed protein product [Vitis vinifera] Length = 935 Score = 61.2 bits (147), Expect = 4e-07 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 E K SYTRDFLLSLSEL++CKKLP GFD S+LSEF+ AS Sbjct: 20 EYQKTLQISYTRDFLLSLSELDICKKLPTGFDHSILSEFEDAS 62 >ref|XP_004306740.1| PREDICTED: uncharacterized protein LOC101311219 [Fragaria vesca subsp. vesca] Length = 1098 Score = 60.8 bits (146), Expect = 5e-07 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGA 4 E KK SYTR+FLLSLSELE CKKLP+GFD S LSEF+ A Sbjct: 20 EVHKKVKISYTREFLLSLSELESCKKLPDGFDRSFLSEFEDA 61 >ref|XP_002320153.1| hypothetical protein POPTR_0014s08510g [Populus trichocarpa] gi|222860926|gb|EEE98468.1| hypothetical protein POPTR_0014s08510g [Populus trichocarpa] Length = 1068 Score = 59.3 bits (142), Expect = 2e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 E+ KK SYTR+FLLSLSEL+VCKKLP GFD SLLSE S Sbjct: 20 ESRKKLKISYTREFLLSLSELDVCKKLPSGFDQSLLSELGDTS 62 >gb|EMJ21489.1| hypothetical protein PRUPE_ppa000517mg [Prunus persica] Length = 1116 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 129 ETSKKPMRSYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGA 4 E KK SYTR+FLLS EL++CKKLP GFD S++SEF+ A Sbjct: 44 EIQKKSKLSYTREFLLSFCELDICKKLPSGFDQSIISEFEDA 85 >ref|XP_006587834.1| PREDICTED: uncharacterized protein LOC100776293 isoform X5 [Glycine max] Length = 992 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 SYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 SYTRDFLLSLS L++C++LP GFD SLLSEF+ AS Sbjct: 26 SYTRDFLLSLSGLDICRELPSGFDRSLLSEFEDAS 60 >ref|XP_006587833.1| PREDICTED: uncharacterized protein LOC100776293 isoform X4 [Glycine max] Length = 993 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 SYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 SYTRDFLLSLS L++C++LP GFD SLLSEF+ AS Sbjct: 26 SYTRDFLLSLSGLDICRELPSGFDRSLLSEFEDAS 60 >ref|XP_006587832.1| PREDICTED: uncharacterized protein LOC100776293 isoform X3 [Glycine max] Length = 1063 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 SYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 SYTRDFLLSLS L++C++LP GFD SLLSEF+ AS Sbjct: 26 SYTRDFLLSLSGLDICRELPSGFDRSLLSEFEDAS 60 >ref|XP_006587831.1| PREDICTED: uncharacterized protein LOC100776293 isoform X2 [Glycine max] Length = 1064 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 SYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 SYTRDFLLSLS L++C++LP GFD SLLSEF+ AS Sbjct: 26 SYTRDFLLSLSGLDICRELPSGFDRSLLSEFEDAS 60 >ref|XP_003533596.1| PREDICTED: uncharacterized protein LOC100776293 isoform X1 [Glycine max] Length = 976 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 105 SYTRDFLLSLSELEVCKKLPEGFDASLLSEFDGAS 1 SYTRDFLLSLS L++C++LP GFD SLLSEF+ AS Sbjct: 26 SYTRDFLLSLSGLDICRELPSGFDRSLLSEFEDAS 60