BLASTX nr result
ID: Achyranthes23_contig00034192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034192 (361 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470664.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 ref|XP_006470663.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 ref|XP_002513525.1| nucleic acid binding protein, putative [Rici... 56 4e-06 >ref|XP_006470664.1| PREDICTED: zinc finger CCCH domain-containing protein 53-like isoform X2 [Citrus sinensis] Length = 640 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 240 DSNGNVQSNENDNKPKAEESELFESGLEHILPDNLFASPKKS 115 + N N N+ + KP ++E++L +S LEHILPDNLFASPKKS Sbjct: 538 NKNNNSDGNDKEEKPNSDENDLCDSSLEHILPDNLFASPKKS 579 >ref|XP_006470663.1| PREDICTED: zinc finger CCCH domain-containing protein 53-like isoform X1 [Citrus sinensis] Length = 641 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 240 DSNGNVQSNENDNKPKAEESELFESGLEHILPDNLFASPKKS 115 + N N N+ + KP ++E++L +S LEHILPDNLFASPKKS Sbjct: 539 NKNNNSDGNDKEEKPNSDENDLCDSSLEHILPDNLFASPKKS 580 >ref|XP_002513525.1| nucleic acid binding protein, putative [Ricinus communis] gi|223547433|gb|EEF48928.1| nucleic acid binding protein, putative [Ricinus communis] Length = 700 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 3/72 (4%) Frame = -2 Query: 312 DNNGSPTGASDEQVVGEG---FNGVLCDSNGNVQSNENDNKPKAEESELFESGLEHILPD 142 +N G P + V +G N V SNGN ++ + K EE++L ES LEHILPD Sbjct: 571 ENGGIPDAVASRNGVADGELEVNPVSNHSNGNSYNSSTEEKSSTEENDLRES-LEHILPD 629 Query: 141 NLFASPKKSVSE 106 NLF SPKKS + Sbjct: 630 NLFTSPKKSAGD 641