BLASTX nr result
ID: Achyranthes23_contig00034076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034076 (214 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525464.1| RNA binding protein, putative [Ricinus commu... 62 8e-08 ref|XP_002319145.2| hypothetical protein POPTR_0013s05120g [Popu... 61 1e-07 ref|XP_002325403.2| RNA recognition motif-containing family prot... 61 1e-07 gb|EXB36255.1| RNA-binding protein 40 [Morus notabilis] 60 2e-07 gb|EOY10725.1| RNA-binding family protein isoform 6 [Theobroma c... 60 2e-07 gb|EOY10723.1| RNA-binding family protein isoform 4 [Theobroma c... 60 2e-07 gb|EOY10720.1| RNA-binding family protein isoform 1 [Theobroma c... 60 2e-07 ref|XP_002465331.1| hypothetical protein SORBIDRAFT_01g036600 [S... 60 2e-07 ref|XP_006479054.1| PREDICTED: RNA-binding protein 40-like isofo... 60 4e-07 ref|XP_006443354.1| hypothetical protein CICLE_v10020067mg [Citr... 60 4e-07 ref|XP_003624600.1| RNA-binding protein [Medicago truncatula] gi... 60 4e-07 ref|XP_006650019.1| PREDICTED: RNA-binding protein 40-like [Oryz... 59 5e-07 ref|XP_006853102.1| hypothetical protein AMTR_s00038p00125360 [A... 59 5e-07 ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Viti... 59 5e-07 ref|NP_001049993.1| Os03g0326600 [Oryza sativa Japonica Group] g... 59 5e-07 gb|EPS65306.1| hypothetical protein M569_09472, partial [Genlise... 59 9e-07 ref|XP_004493140.1| PREDICTED: RNA-binding protein 40-like isofo... 59 9e-07 ref|XP_004493139.1| PREDICTED: RNA-binding protein 40-like isofo... 59 9e-07 ref|XP_006359619.1| PREDICTED: RNA-binding protein 40-like isofo... 57 3e-06 tpg|DAA45145.1| TPA: hypothetical protein ZEAMMB73_529929 [Zea m... 56 4e-06 >ref|XP_002525464.1| RNA binding protein, putative [Ricinus communis] gi|223535277|gb|EEF36954.1| RNA binding protein, putative [Ricinus communis] Length = 450 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 102 AKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 A STLLIRHLPEAIP + LSRLFSHYGA SVRPC+ Sbjct: 7 AVSTLLIRHLPEAIPHETLSRLFSHYGATSVRPCA 41 >ref|XP_002319145.2| hypothetical protein POPTR_0013s05120g [Populus trichocarpa] gi|550325000|gb|EEE95068.2| hypothetical protein POPTR_0013s05120g [Populus trichocarpa] Length = 479 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 111 TLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 TLLI+HLPE IPFD LSRLFSHYGA SVRPC++ Sbjct: 37 TLLIKHLPEDIPFDTLSRLFSHYGAFSVRPCNS 69 >ref|XP_002325403.2| RNA recognition motif-containing family protein, partial [Populus trichocarpa] gi|550316797|gb|EEE99784.2| RNA recognition motif-containing family protein, partial [Populus trichocarpa] Length = 420 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 111 TLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 TLLI+HLPEAIPF LSRLFSHYGA+SVRPC++ Sbjct: 37 TLLIKHLPEAIPFKTLSRLFSHYGAVSVRPCNS 69 >gb|EXB36255.1| RNA-binding protein 40 [Morus notabilis] Length = 486 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +3 Query: 102 AKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 A STLLIRHLPEAIP LSRLFSHYGA SVRPC++ Sbjct: 35 AASTLLIRHLPEAIPEPTLSRLFSHYGASSVRPCTS 70 >gb|EOY10725.1| RNA-binding family protein isoform 6 [Theobroma cacao] Length = 436 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 108 STLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 +TLLIRHLPEAIP D L RLFSHYGA SVRPCS+ Sbjct: 37 TTLLIRHLPEAIPHDTLLRLFSHYGASSVRPCSS 70 >gb|EOY10723.1| RNA-binding family protein isoform 4 [Theobroma cacao] Length = 487 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 108 STLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 +TLLIRHLPEAIP D L RLFSHYGA SVRPCS+ Sbjct: 37 TTLLIRHLPEAIPHDTLLRLFSHYGASSVRPCSS 70 >gb|EOY10720.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508718824|gb|EOY10721.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508718825|gb|EOY10722.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 479 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 108 STLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 +TLLIRHLPEAIP D L RLFSHYGA SVRPCS+ Sbjct: 37 TTLLIRHLPEAIPHDTLLRLFSHYGASSVRPCSS 70 >ref|XP_002465331.1| hypothetical protein SORBIDRAFT_01g036600 [Sorghum bicolor] gi|241919185|gb|EER92329.1| hypothetical protein SORBIDRAFT_01g036600 [Sorghum bicolor] Length = 467 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = +3 Query: 21 PHPNSQHHQQPNEGGXXXXXXXXXXXKAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRP 200 P P HH Q +G +TLL+RHLPEAI + LSRLFSHYGA SVRP Sbjct: 23 PPPLHHHHHQQQQG---------PAPPGAATLLVRHLPEAITQEMLSRLFSHYGATSVRP 73 Query: 201 CS 206 CS Sbjct: 74 CS 75 >ref|XP_006479054.1| PREDICTED: RNA-binding protein 40-like isoform X2 [Citrus sinensis] Length = 389 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 111 TLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 TLLI+HLP+AIP D LSR+FSHYGA SVRPCSA Sbjct: 21 TLLIKHLPDAIPQDTLSRIFSHYGASSVRPCSA 53 >ref|XP_006443354.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|567901734|ref|XP_006443355.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|568850729|ref|XP_006479053.1| PREDICTED: RNA-binding protein 40-like isoform X1 [Citrus sinensis] gi|557545616|gb|ESR56594.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] gi|557545617|gb|ESR56595.1| hypothetical protein CICLE_v10020067mg [Citrus clementina] Length = 461 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 111 TLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 TLLI+HLP+AIP D LSR+FSHYGA SVRPCSA Sbjct: 21 TLLIKHLPDAIPQDTLSRIFSHYGASSVRPCSA 53 >ref|XP_003624600.1| RNA-binding protein [Medicago truncatula] gi|355499615|gb|AES80818.1| RNA-binding protein [Medicago truncatula] Length = 492 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 99 KAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 ++ +TLLI+HLP+AIP D LSRL SHYGA SVRPCSA Sbjct: 23 ESPATLLIKHLPDAIPHDTLSRLLSHYGASSVRPCSA 59 >ref|XP_006650019.1| PREDICTED: RNA-binding protein 40-like [Oryza brachyantha] Length = 460 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +3 Query: 102 AKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 A +TLL+RHLPEAIP + LSRLFSHYGA SVRPC+ Sbjct: 34 AAATLLVRHLPEAIPQEMLSRLFSHYGATSVRPCA 68 >ref|XP_006853102.1| hypothetical protein AMTR_s00038p00125360 [Amborella trichopoda] gi|548856741|gb|ERN14569.1| hypothetical protein AMTR_s00038p00125360 [Amborella trichopoda] Length = 471 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 108 STLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 +TLL+RHLPEAIP + LSRLFSHYGA SVRPC+ Sbjct: 26 ATLLVRHLPEAIPHETLSRLFSHYGASSVRPCA 58 >ref|XP_002270244.2| PREDICTED: RNA-binding protein 40-like [Vitis vinifera] gi|298205172|emb|CBI17231.3| unnamed protein product [Vitis vinifera] Length = 463 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 99 KAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 K+ +TLLIRHLPEAIP D LSRLFS YGA SVRPC++ Sbjct: 18 KSAATLLIRHLPEAIPQDTLSRLFSSYGASSVRPCTS 54 >ref|NP_001049993.1| Os03g0326600 [Oryza sativa Japonica Group] gi|108707928|gb|ABF95723.1| RNA recognition motif family protein, expressed [Oryza sativa Japonica Group] gi|113548464|dbj|BAF11907.1| Os03g0326600 [Oryza sativa Japonica Group] gi|218192743|gb|EEC75170.1| hypothetical protein OsI_11395 [Oryza sativa Indica Group] Length = 467 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/62 (51%), Positives = 36/62 (58%) Frame = +3 Query: 21 PHPNSQHHQQPNEGGXXXXXXXXXXXKAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRP 200 P P Q QQP +TLL+RHLPEAIP + LSRLFSHYGA SVRP Sbjct: 25 PPPPQQQQQQPPGSAPPA-----------ATLLVRHLPEAIPQEMLSRLFSHYGATSVRP 73 Query: 201 CS 206 C+ Sbjct: 74 CA 75 >gb|EPS65306.1| hypothetical protein M569_09472, partial [Genlisea aurea] Length = 433 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 111 TLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 TLL+RHLPEAIPF+ L+RLFSHYGA SVR CS Sbjct: 10 TLLVRHLPEAIPFETLTRLFSHYGAASVRHCS 41 >ref|XP_004493140.1| PREDICTED: RNA-binding protein 40-like isoform X2 [Cicer arietinum] Length = 439 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 99 KAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 ++ +TLLI+HLP+AIP D LSRL SHYGA SVRPCS Sbjct: 23 ESSATLLIKHLPDAIPHDTLSRLLSHYGASSVRPCS 58 >ref|XP_004493139.1| PREDICTED: RNA-binding protein 40-like isoform X1 [Cicer arietinum] Length = 459 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 99 KAKSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 ++ +TLLI+HLP+AIP D LSRL SHYGA SVRPCS Sbjct: 23 ESSATLLIKHLPDAIPHDTLSRLLSHYGASSVRPCS 58 >ref|XP_006359619.1| PREDICTED: RNA-binding protein 40-like isoform X1 [Solanum tuberosum] gi|565387688|ref|XP_006359620.1| PREDICTED: RNA-binding protein 40-like isoform X2 [Solanum tuberosum] gi|565387690|ref|XP_006359621.1| PREDICTED: RNA-binding protein 40-like isoform X3 [Solanum tuberosum] gi|565387692|ref|XP_006359622.1| PREDICTED: RNA-binding protein 40-like isoform X4 [Solanum tuberosum] gi|565387694|ref|XP_006359623.1| PREDICTED: RNA-binding protein 40-like isoform X5 [Solanum tuberosum] gi|565387696|ref|XP_006359624.1| PREDICTED: RNA-binding protein 40-like isoform X6 [Solanum tuberosum] Length = 452 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +3 Query: 105 KSTLLIRHLPEAIPFDNLSRLFSHYGALSVRPCSA 209 +STLLIRHLPEAIP + LSRL S+YGA S+RPC++ Sbjct: 23 ESTLLIRHLPEAIPHETLSRLLSNYGATSIRPCTS 57 >tpg|DAA45145.1| TPA: hypothetical protein ZEAMMB73_529929 [Zea mays] Length = 396 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 108 STLLIRHLPEAIPFDNLSRLFSHYGALSVRPCS 206 +TLL+RHLPEAI + LSRLFSHYGA SVRPCS Sbjct: 26 ATLLVRHLPEAITQEMLSRLFSHYGATSVRPCS 58