BLASTX nr result
ID: Achyranthes23_contig00034073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00034073 (303 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citr... 61 1e-07 >ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina] gi|568865012|ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis] gi|557538467|gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina] Length = 456 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +2 Query: 167 ILGCLWLLILSCFSVTLLADQERDRITWLPGQPENVNFAQYSGYV 301 +LG L+L++ SCFS +L ADQ++D+IT LPGQP NV+F QYSGYV Sbjct: 8 VLGFLYLVLCSCFSYSL-ADQDKDKITVLPGQPTNVDFNQYSGYV 51