BLASTX nr result
ID: Achyranthes23_contig00033809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00033809 (638 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Popu... 62 1e-07 ref|XP_003543284.1| PREDICTED: probable leucine-rich repeat rece... 62 1e-07 ref|XP_006370597.1| hypothetical protein POPTR_0001s44100g [Popu... 60 7e-07 ref|XP_002522815.1| serine/threonine-specific protein kinase, pu... 59 2e-06 ref|NP_001241300.1| probable leucine-rich repeat receptor-like s... 57 3e-06 gb|ESW21673.1| hypothetical protein PHAVU_005G090000g [Phaseolus... 57 5e-06 ref|XP_006475288.1| PREDICTED: probable leucine-rich repeat rece... 56 8e-06 ref|XP_006452129.1| hypothetical protein CICLE_v100083511mg [Cit... 56 8e-06 >ref|XP_002316964.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] gi|222860029|gb|EEE97576.1| hypothetical protein POPTR_0011s13470g [Populus trichocarpa] Length = 430 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 2/64 (3%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEV--PPSENRPKREESID 465 SMRDIVQ LSRILK RH+KK H S + T +EV++D++Q E+ P SE+ +REES+D Sbjct: 365 SMRDIVQVLSRILKLRHNKKHHKKSLS-ATTADEVSIDMDQQEIRTPLSEHHHRREESVD 423 Query: 464 IMDT 453 DT Sbjct: 424 SADT 427 >ref|XP_003543284.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X1 [Glycine max] gi|571501447|ref|XP_006594803.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X2 [Glycine max] gi|571501454|ref|XP_006594804.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X3 [Glycine max] gi|571501458|ref|XP_006594805.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X4 [Glycine max] gi|571501462|ref|XP_006594806.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X5 [Glycine max] Length = 431 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/58 (55%), Positives = 44/58 (75%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEVPPSENRPKREESID 465 SMRDIVQ L+RILK+RH +++H H SLS T +EV++D++Q+E S +REESID Sbjct: 367 SMRDIVQVLTRILKSRH-QRNHHHNKSLSATADEVSIDVDQLETKNSVTDHRREESID 423 >ref|XP_006370597.1| hypothetical protein POPTR_0001s44100g [Populus trichocarpa] gi|550349803|gb|ERP67166.1| hypothetical protein POPTR_0001s44100g [Populus trichocarpa] Length = 428 Score = 59.7 bits (143), Expect = 7e-07 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEV-PPSENRPKREESIDI 462 SMRDIVQ LSRILK RH+KK H S + T +EV+ D++Q E+ P +R +REES+D Sbjct: 364 SMRDIVQVLSRILKLRHNKKHHKKSLS-AATADEVSFDMDQQEIRTPVSDRHRREESVDS 422 Query: 461 MDT 453 DT Sbjct: 423 ADT 425 >ref|XP_002522815.1| serine/threonine-specific protein kinase, putative [Ricinus communis] gi|223537899|gb|EEF39513.1| serine/threonine-specific protein kinase, putative [Ricinus communis] Length = 431 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEV-PPSENRPKREESIDI 462 +MRDIVQ L+RILK+RHS++ H SLS T +EV++D++Q+EV P +REES+D Sbjct: 367 AMRDIVQVLARILKSRHSRRHHK--KSLSATADEVSIDMDQLEVKTPVSECHRREESMDS 424 Query: 461 MDT 453 DT Sbjct: 425 ADT 427 >ref|NP_001241300.1| probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like [Glycine max] gi|571491375|ref|XP_006591912.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X1 [Glycine max] gi|571491377|ref|XP_006591913.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X2 [Glycine max] gi|223452504|gb|ACM89579.1| protein kinase family protein [Glycine max] Length = 431 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/58 (51%), Positives = 43/58 (74%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEVPPSENRPKREESID 465 SMRDIVQ +RILK+R+ +++H H SLS T +EV++D++Q+E S +REESID Sbjct: 367 SMRDIVQVFTRILKSRY-QRNHHHKKSLSATVDEVSIDVDQLETKSSVTDHRREESID 423 >gb|ESW21673.1| hypothetical protein PHAVU_005G090000g [Phaseolus vulgaris] gi|561022944|gb|ESW21674.1| hypothetical protein PHAVU_005G090000g [Phaseolus vulgaris] gi|561022945|gb|ESW21675.1| hypothetical protein PHAVU_005G090000g [Phaseolus vulgaris] Length = 431 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/58 (51%), Positives = 42/58 (72%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEVPPSENRPKREESID 465 SMRDIVQ +RILK+RH +++H H SLS T +EV++D++ +E S + REESID Sbjct: 367 SMRDIVQVFTRILKSRH-QRNHHHKNSLSATADEVSIDVDHLETNTSLPQHTREESID 423 >ref|XP_006475288.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X1 [Citrus sinensis] gi|568842733|ref|XP_006475289.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730-like isoform X2 [Citrus sinensis] Length = 432 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEVPPSENRPKREESID 465 SMRDIVQ LSRILKTRH++K H S S T +EV++D+ Q E + REES+D Sbjct: 369 SMRDIVQVLSRILKTRHNRKH--HRKSQSTTADEVSIDMEQAEAKTPTSTHLREESVD 424 >ref|XP_006452129.1| hypothetical protein CICLE_v100083511mg [Citrus clementina] gi|557555355|gb|ESR65369.1| hypothetical protein CICLE_v100083511mg [Citrus clementina] Length = 432 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = -1 Query: 638 SMRDIVQGLSRILKTRHSKKSHPHGTSLSPTPEEVAVDINQVEVPPSENRPKREESID 465 SMRDIVQ LSRILKTRH++K H S S T +EV++D+ Q E + REES+D Sbjct: 369 SMRDIVQVLSRILKTRHNRKH--HRKSQSTTADEVSIDMEQAEAKTPTSTHLREESVD 424