BLASTX nr result
ID: Achyranthes23_contig00033785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00033785 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26143.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002277125.1| PREDICTED: receptor-like cytosolic serine/th... 57 2e-06 ref|XP_004164632.1| PREDICTED: receptor-like cytosolic serine/th... 57 3e-06 ref|XP_004145041.1| PREDICTED: receptor-like cytosolic serine/th... 57 3e-06 >emb|CBI26143.3| unnamed protein product [Vitis vinifera] Length = 487 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 5 KLVQRPSLRRTYSEELLDAEEYNSTKYLSDVDHLMQIALEL 127 K Q+P L+RTYSEELLDAEEYNSTK+L+D+ M+I LE+ Sbjct: 447 KRYQKPILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLEI 487 >ref|XP_002277125.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2-like [Vitis vinifera] Length = 507 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 5 KLVQRPSLRRTYSEELLDAEEYNSTKYLSDVDHLMQIALEL 127 K Q+P L+RTYSEELLDAEEYNSTK+L+D+ M+I LE+ Sbjct: 467 KRYQKPILQRTYSEELLDAEEYNSTKHLNDLSRHMEILLEI 507 >ref|XP_004164632.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2-like [Cucumis sativus] Length = 524 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 14 QRPSLRRTYSEELLDAEEYNSTKYLSDVDHLMQIAL 121 Q+ L+RTYSEELLDAEEYNSTKYLSD+D ++I L Sbjct: 482 QKSKLQRTYSEELLDAEEYNSTKYLSDIDRHLEIVL 517 >ref|XP_004145041.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2-like [Cucumis sativus] gi|449474089|ref|XP_004154070.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase RBK2-like [Cucumis sativus] Length = 549 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +2 Query: 14 QRPSLRRTYSEELLDAEEYNSTKYLSDVDHLMQIAL 121 Q+ L+RTYSEELLDAEEYNSTKYLSD+D ++I L Sbjct: 507 QKSKLQRTYSEELLDAEEYNSTKYLSDIDRHLEIVL 542