BLASTX nr result
ID: Achyranthes23_contig00032845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00032845 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006401202.1| hypothetical protein EUTSA_v10015707mg [Eutr... 57 2e-06 ref|XP_003610125.1| hypothetical protein MTR_4g128210 [Medicago ... 56 6e-06 ref|XP_006280166.1| hypothetical protein CARUB_v10026064mg [Caps... 55 1e-05 ref|XP_002864518.1| hypothetical protein ARALYDRAFT_495846 [Arab... 55 1e-05 >ref|XP_006401202.1| hypothetical protein EUTSA_v10015707mg [Eutrema salsugineum] gi|557102292|gb|ESQ42655.1| hypothetical protein EUTSA_v10015707mg [Eutrema salsugineum] Length = 626 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 20 VVCCVKFCVVGSKTLSGVSIWPVSEAKTEFYVVDHKVETGTYMSN 154 ++C VKF V GS +LSG+S+ +E T+FY VDHK ETG YM N Sbjct: 582 IICYVKFSVQGSSSLSGISLRAAAEGNTDFYEVDHKYETGIYMCN 626 >ref|XP_003610125.1| hypothetical protein MTR_4g128210 [Medicago truncatula] gi|355511180|gb|AES92322.1| hypothetical protein MTR_4g128210 [Medicago truncatula] Length = 635 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 20 VVCCVKFCVVGSKTLSGVSIWPVSEAKTEFYVVDHKVETGTYMSN 154 VV VKF V ++TLSGVSI P SE KT+FY V HK+E+G YM N Sbjct: 591 VVGYVKFSVQTTETLSGVSIRPASEGKTDFYEVSHKLESGVYMCN 635 >ref|XP_006280166.1| hypothetical protein CARUB_v10026064mg [Capsella rubella] gi|482548870|gb|EOA13064.1| hypothetical protein CARUB_v10026064mg [Capsella rubella] Length = 644 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 20 VVCCVKFCVVGSKTLSGVSIWPVSEAKTEFYVVDHKVETGTYMSN 154 ++C VKF V G+ +LSG+S+ +E T+FY VDH+ ETG YM N Sbjct: 600 IICYVKFSVQGNTSLSGISLRAAAEGNTDFYEVDHRYETGVYMCN 644 >ref|XP_002864518.1| hypothetical protein ARALYDRAFT_495846 [Arabidopsis lyrata subsp. lyrata] gi|297310353|gb|EFH40777.1| hypothetical protein ARALYDRAFT_495846 [Arabidopsis lyrata subsp. lyrata] Length = 642 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/45 (51%), Positives = 32/45 (71%) Frame = +2 Query: 20 VVCCVKFCVVGSKTLSGVSIWPVSEAKTEFYVVDHKVETGTYMSN 154 ++C VKF V G+ +LSG+S+ +E T+FY VDH+ ETG YM N Sbjct: 598 IICYVKFSVQGNTSLSGISLRAAAEGNTDFYEVDHRYETGVYMCN 642