BLASTX nr result
ID: Achyranthes23_contig00032580
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00032580 (323 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC10949.1| ER lumen protein retaining receptor [Morus notabi... 65 1e-08 ref|NP_001241529.1| uncharacterized protein LOC100780011 precurs... 60 4e-07 gb|ABK22024.1| unknown [Picea sitchensis] 60 4e-07 gb|ESW12619.1| hypothetical protein PHAVU_008G128000g [Phaseolus... 59 5e-07 ref|XP_006415584.1| hypothetical protein EUTSA_v10008757mg [Eutr... 59 5e-07 gb|AFK45006.1| unknown [Lotus japonicus] 59 5e-07 gb|AFK37736.1| unknown [Lotus japonicus] 59 5e-07 gb|ADI60301.1| ER luminal protein receptor 2b [Nicotiana bentham... 59 5e-07 ref|XP_006836458.1| hypothetical protein AMTR_s00228p00021360 [A... 59 7e-07 ref|XP_002518084.1| er lumen protein retaining receptor, putativ... 59 7e-07 gb|EOY05274.1| Endoplasmic reticulum retention defective 2B [The... 59 9e-07 ref|XP_002522261.1| er lumen protein retaining receptor, putativ... 59 9e-07 ref|NP_001052584.1| Os04g0376700 [Oryza sativa Japonica Group] g... 58 1e-06 gb|AFK37187.1| unknown [Medicago truncatula] 58 1e-06 ref|NP_001237746.1| uncharacterized protein LOC100527553 [Glycin... 58 1e-06 gb|EEE60855.1| hypothetical protein OsJ_14496 [Oryza sativa Japo... 58 1e-06 emb|CAH66350.1| OSIGBa0135C09.1 [Oryza sativa Indica Group] gi|1... 58 1e-06 ref|XP_004513522.1| PREDICTED: ER lumen protein retaining recept... 58 2e-06 ref|XP_002960081.1| hypothetical protein SELMODRAFT_75833 [Selag... 58 2e-06 ref|XP_006467606.1| PREDICTED: ER lumen protein retaining recept... 57 3e-06 >gb|EXC10949.1| ER lumen protein retaining receptor [Morus notabilis] Length = 215 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RR+YDK DTF HYFLVLGCFVLAL++HEKFT+QE Sbjct: 85 RRTYDKEIDTFRHYFLVLGCFVLALLLHEKFTVQE 119 >ref|NP_001241529.1| uncharacterized protein LOC100780011 precursor [Glycine max] gi|255638536|gb|ACU19576.1| unknown [Glycine max] gi|255639213|gb|ACU19905.1| unknown [Glycine max] Length = 215 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFLVL C +LAL+I+EKFTL+E Sbjct: 85 RRSYDKDQDTFRHYFLVLPCLLLALLINEKFTLKE 119 >gb|ABK22024.1| unknown [Picea sitchensis] Length = 215 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HY LV+ CF+LAL++H+KFT +E Sbjct: 85 RRSYDKEQDTFRHYLLVIPCFILALLVHDKFTFRE 119 >gb|ESW12619.1| hypothetical protein PHAVU_008G128000g [Phaseolus vulgaris] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L C VLAL+I+EKFT++E Sbjct: 85 RRSYDKDQDTFRHYFLILPCLVLALLINEKFTVKE 119 >ref|XP_006415584.1| hypothetical protein EUTSA_v10008757mg [Eutrema salsugineum] gi|557093355|gb|ESQ33937.1| hypothetical protein EUTSA_v10008757mg [Eutrema salsugineum] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK DTF H F+VL CFVLALI+HE+FT+QE Sbjct: 85 RRSYDKDLDTFRHQFVVLACFVLALILHERFTIQE 119 >gb|AFK45006.1| unknown [Lotus japonicus] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L CF+LAL+++EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLILPCFLLALLLNEKFTFKE 119 >gb|AFK37736.1| unknown [Lotus japonicus] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L CF+LAL+++EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLILPCFLLALLLNEKFTFKE 119 >gb|ADI60301.1| ER luminal protein receptor 2b [Nicotiana benthamiana] Length = 215 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF H FLVL C VLAL+IHEKFT +E Sbjct: 85 RRSYDKDQDTFRHIFLVLPCLVLALVIHEKFTFKE 119 >ref|XP_006836458.1| hypothetical protein AMTR_s00228p00021360 [Amborella trichopoda] gi|548838981|gb|ERM99311.1| hypothetical protein AMTR_s00228p00021360 [Amborella trichopoda] Length = 253 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L C VLAL+I+EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLILPCLVLALLINEKFTFRE 119 >ref|XP_002518084.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223542680|gb|EEF44217.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 206 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTFHH+FLV C + AL+IHE+FT +E Sbjct: 76 RRSYDKEQDTFHHFFLVAPCLIFALLIHERFTFKE 110 >gb|EOY05274.1| Endoplasmic reticulum retention defective 2B [Theobroma cacao] Length = 215 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L C +LALII+EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLMLPCLILALIINEKFTFRE 119 >ref|XP_002522261.1| er lumen protein retaining receptor, putative [Ricinus communis] gi|223538514|gb|EEF40119.1| er lumen protein retaining receptor, putative [Ricinus communis] Length = 215 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 +RSYDK DTF HYFLV CFVLAL +HEKFT +E Sbjct: 85 KRSYDKELDTFRHYFLVAACFVLALFVHEKFTFRE 119 >ref|NP_001052584.1| Os04g0376700 [Oryza sativa Japonica Group] gi|21743051|emb|CAD40684.1| OSJNBa0083D01.1 [Oryza sativa Japonica Group] gi|38346120|emb|CAE04598.2| OSJNBb0006N15.15 [Oryza sativa Japonica Group] gi|113564155|dbj|BAF14498.1| Os04g0376700 [Oryza sativa Japonica Group] Length = 215 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK DTF H FLVL CF+LAL+IHEKFT +E Sbjct: 85 RRSYDKDHDTFRHQFLVLPCFLLALLIHEKFTFRE 119 >gb|AFK37187.1| unknown [Medicago truncatula] Length = 215 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFLVL C +LAL+I+EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLVLPCLLLALLINEKFTFKE 119 >ref|NP_001237746.1| uncharacterized protein LOC100527553 [Glycine max] gi|255632598|gb|ACU16649.1| unknown [Glycine max] Length = 215 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFLVL C +LAL+I+EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLVLPCLLLALLINEKFTFKE 119 >gb|EEE60855.1| hypothetical protein OsJ_14496 [Oryza sativa Japonica Group] Length = 490 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK DTF H FLVL CF+LAL+IHEKFT +E Sbjct: 85 RRSYDKDHDTFRHQFLVLPCFLLALLIHEKFTFRE 119 >emb|CAH66350.1| OSIGBa0135C09.1 [Oryza sativa Indica Group] gi|125547978|gb|EAY93800.1| hypothetical protein OsI_15578 [Oryza sativa Indica Group] Length = 215 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK DTF H FLVL CF+LAL+IHEKFT +E Sbjct: 85 RRSYDKDHDTFRHQFLVLPCFLLALLIHEKFTFRE 119 >ref|XP_004513522.1| PREDICTED: ER lumen protein retaining receptor-like [Cicer arietinum] Length = 215 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RRSYDK QDTF HYFL+L C +LAL+I+EKFT +E Sbjct: 85 RRSYDKDQDTFRHYFLILPCLLLALLINEKFTFKE 119 >ref|XP_002960081.1| hypothetical protein SELMODRAFT_75833 [Selaginella moellendorffii] gi|302804614|ref|XP_002984059.1| hypothetical protein SELMODRAFT_119519 [Selaginella moellendorffii] gi|300148411|gb|EFJ15071.1| hypothetical protein SELMODRAFT_119519 [Selaginella moellendorffii] gi|300171020|gb|EFJ37620.1| hypothetical protein SELMODRAFT_75833 [Selaginella moellendorffii] Length = 215 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RR+YDK QDTF HYFLVL C +LAL+IH+KFT E Sbjct: 85 RRTYDKEQDTFRHYFLVLPCLLLALVIHKKFTFLE 119 >ref|XP_006467606.1| PREDICTED: ER lumen protein retaining receptor-like [Citrus sinensis] Length = 215 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 RRSYDKAQDTFHHYFLVLGCFVLALIIHEKFTLQE 105 RR+YDK DTF HYFL+ CFVL+LI++EKFT QE Sbjct: 85 RRTYDKELDTFRHYFLIAACFVLSLILNEKFTFQE 119