BLASTX nr result
ID: Achyranthes23_contig00032501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00032501 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477700.1| PREDICTED: uncharacterized protein LOC102607... 59 5e-07 ref|XP_006440790.1| hypothetical protein CICLE_v10020129mg [Citr... 59 5e-07 ref|XP_002265430.1| PREDICTED: uncharacterized protein LOC100256... 59 9e-07 gb|EMJ11297.1| hypothetical protein PRUPE_ppa019254mg [Prunus pe... 57 2e-06 gb|EOY04870.1| Mitochondrial transcription termination factor fa... 56 6e-06 ref|XP_002514634.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_006579258.1| PREDICTED: uncharacterized protein LOC100783... 55 1e-05 >ref|XP_006477700.1| PREDICTED: uncharacterized protein LOC102607736 [Citrus sinensis] Length = 449 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 188 LFQRFSEYVEKNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFLV 322 L+ RFS K+RHPVGLWK FKP PES+EDV+N+K+F E LV Sbjct: 405 LYGRFSGGEVKSRHPVGLWKLFKPPSYPESKEDVRNMKAFMETLV 449 >ref|XP_006440790.1| hypothetical protein CICLE_v10020129mg [Citrus clementina] gi|557543052|gb|ESR54030.1| hypothetical protein CICLE_v10020129mg [Citrus clementina] Length = 449 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +2 Query: 188 LFQRFSEYVEKNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFLV 322 L+ RFS K+RHPVGLWK FKP PES+EDV+N+K+F E LV Sbjct: 405 LYGRFSGGEVKSRHPVGLWKLFKPPSYPESKEDVRNMKAFMETLV 449 >ref|XP_002265430.1| PREDICTED: uncharacterized protein LOC100256963 [Vitis vinifera] gi|297734077|emb|CBI15324.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/45 (64%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +2 Query: 188 LFQRFSEYVE-KNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFL 319 +F RFS VE +NRHPVGLWK KP K PES++DVKN+K F E L Sbjct: 407 MFGRFSRDVEVRNRHPVGLWKLMKPQKHPESKDDVKNMKCFVESL 451 >gb|EMJ11297.1| hypothetical protein PRUPE_ppa019254mg [Prunus persica] Length = 455 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/57 (52%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 152 NTLYRKHISLAALFQRFSEYVE-KNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFL 319 N + + A +F RFS V+ ++RHPVGLWK FKP + PES+EDVKN K F E L Sbjct: 398 NLYVKPYPDCAKMFGRFSGDVKVQSRHPVGLWKLFKPQRYPESKEDVKNTKLFMESL 454 >gb|EOY04870.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] gi|508712974|gb|EOY04871.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] gi|508712975|gb|EOY04872.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] gi|508712976|gb|EOY04873.1| Mitochondrial transcription termination factor family protein, putative isoform 1 [Theobroma cacao] Length = 439 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/46 (63%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +2 Query: 188 LFQRFSEYV-EKNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFLV 322 LF RF E + RHPVG+WK FKP K ES+EDVKN+KSF E LV Sbjct: 394 LFGRFVEDAGHQRRHPVGMWKLFKPQKYTESKEDVKNMKSFMEPLV 439 >ref|XP_002514634.1| conserved hypothetical protein [Ricinus communis] gi|223546238|gb|EEF47740.1| conserved hypothetical protein [Ricinus communis] Length = 450 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/58 (50%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +2 Query: 152 NTLYRKHISLAALFQRFSEYVE-KNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFLV 322 N + + +F R S V+ K +HPVGLWK FKP P+S+EDVKN+KSF E LV Sbjct: 393 NLYVKPYPECGKMFGRLSGDVQVKRQHPVGLWKMFKPQMHPDSKEDVKNMKSFMEDLV 450 >ref|XP_006579258.1| PREDICTED: uncharacterized protein LOC100783135 [Glycine max] Length = 376 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +2 Query: 218 KNRHPVGLWKHFKPLKCPESREDVKNLKSFSEFLV 322 K +HPVGLWK FKP K PES EDVKN++SF E LV Sbjct: 342 KRKHPVGLWKLFKPEKFPESGEDVKNMRSFMESLV 376