BLASTX nr result
ID: Achyranthes23_contig00031883
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00031883 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564568.1| SNF2 and helicase domain-containing protein [Ar... 67 3e-09 ref|XP_002891574.1| SNF2 domain-containing protein [Arabidopsis ... 64 2e-08 gb|EMJ28209.1| hypothetical protein PRUPE_ppa001306mg [Prunus pe... 64 3e-08 ref|XP_002883222.1| SNF2 domain-containing protein [Arabidopsis ... 64 3e-08 ref|XP_006306192.1| hypothetical protein CARUB_v10011822mg [Caps... 61 1e-07 gb|EXB96365.1| SMARCA3-like protein 2 [Morus notabilis] 59 5e-07 ref|NP_188635.1| RING finger-related, SNF2 and helicase domain-c... 59 5e-07 ref|XP_006345299.1| PREDICTED: uncharacterized ATP-dependent hel... 58 1e-06 ref|XP_006345296.1| PREDICTED: uncharacterized ATP-dependent hel... 58 1e-06 ref|XP_006406428.1| hypothetical protein EUTSA_v10020061mg [Eutr... 58 1e-06 gb|EOX99038.1| SNF2 domain-containing protein / helicase domain-... 58 1e-06 gb|EOX99037.1| SNF2 domain-containing protein / helicase domain-... 58 1e-06 gb|EOX99036.1| SNF2 domain-containing protein / helicase domain-... 58 1e-06 gb|EOX99035.1| SNF2 domain-containing protein / helicase domain-... 58 1e-06 ref|XP_004231724.1| PREDICTED: uncharacterized ATP-dependent hel... 58 1e-06 ref|XP_002513133.1| DNA repair helicase rad5,16, putative [Ricin... 55 1e-05 >ref|NP_564568.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|14532630|gb|AAK64043.1| putative DNA-binding protein [Arabidopsis thaliana] gi|23296945|gb|AAN13207.1| putative DNA-binding protein [Arabidopsis thaliana] gi|332194424|gb|AEE32545.1| SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Length = 981 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP ++A G + S + + +SDP G GE+R DER+IYQAALQ ++QP E+D+P Sbjct: 159 ILPPSVAHGTSASPSHFNGLSDPMHRNGIGEERNSENDERLIYQAALQELNQPKSEVDLP 218 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 219 AGLLSVPL 226 >ref|XP_002891574.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337416|gb|EFH67833.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 980 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP ++A G + S + + +SDP G E+R DER+IYQAALQ ++QP E+D+P Sbjct: 159 ILPPSVAHGTSASPSHFNGLSDPMHRNGIAEERNSENDERLIYQAALQELNQPKSEVDLP 218 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 219 AGLLSVPL 226 >gb|EMJ28209.1| hypothetical protein PRUPE_ppa001306mg [Prunus persica] Length = 857 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 +LP T GK+ S++ + SDP + G GE+RV DER+IYQAAL++++QP E +P Sbjct: 40 VLPPTFMHGKSFSTSQFASSSDPPYHPGIGEERVTDSDERLIYQAALEDLNQPKVEATLP 99 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 100 DGLLSVPL 107 >ref|XP_002883222.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329062|gb|EFH59481.1| SNF2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1046 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP +L G + S + SDP +G GEDR DER++YQAALQ+++QP E D+P Sbjct: 213 ILPPSLTHGTSASVLHHAGSSDPMHRLGTGEDRNPDNDERLVYQAALQDLNQPITESDLP 272 Query: 178 KGVLTVPL 201 GVL+VPL Sbjct: 273 PGVLSVPL 280 >ref|XP_006306192.1| hypothetical protein CARUB_v10011822mg [Capsella rubella] gi|482574903|gb|EOA39090.1| hypothetical protein CARUB_v10011822mg [Capsella rubella] Length = 997 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/68 (48%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP ++A G + S + SDP G GEDR DER+IYQAALQ ++Q E+D+P Sbjct: 174 ILPSSVAHGTSVSPSHVNGFSDPVHRNGTGEDRNSDNDERLIYQAALQELNQSKSEVDLP 233 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 234 AGLLSVPL 241 >gb|EXB96365.1| SMARCA3-like protein 2 [Morus notabilis] Length = 753 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP +L K+ + + SD G GE++V DER+IYQAAL++++QP GE +P Sbjct: 196 ILPPSLTHVKSTGAVQFGTASDSAHRSGIGEEKVAEADERLIYQAALEDLNQPKGEAILP 255 Query: 178 KGVLTVPL 201 +G+L+VPL Sbjct: 256 EGLLSVPL 263 >ref|NP_188635.1| RING finger-related, SNF2 and helicase domain-containing protein [Arabidopsis thaliana] gi|11994776|dbj|BAB03166.1| transcription factor-like protein [Arabidopsis thaliana] gi|332642797|gb|AEE76318.1| RING finger-related, SNF2 and helicase domain-containing protein [Arabidopsis thaliana] Length = 1047 Score = 59.3 bits (142), Expect = 5e-07 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP +L G + S + SDP G GEDR DER++YQAALQ ++QP E D+P Sbjct: 214 ILPPSLTHGTSASVLHHAGSSDPMHRFGGGEDRNPDNDERLVYQAALQVLNQPMTESDLP 273 Query: 178 KGVLTVPL 201 G L+VPL Sbjct: 274 PGTLSVPL 281 >ref|XP_006345299.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X4 [Solanum tuberosum] Length = 959 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVMG-DERVIYQAALQNISQPDGELDVP 177 +LP +L KA S YT ++DP G E+R DER+I+QAALQ+++QP E +P Sbjct: 159 VLPPSLMHRKATSGVQYTSVNDPLHYPGTAEERAAAADERLIFQAALQDLNQPKVEARLP 218 Query: 178 KGVLTVPL 201 +G+L+V L Sbjct: 219 EGLLSVSL 226 >ref|XP_006345296.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X1 [Solanum tuberosum] gi|565356898|ref|XP_006345297.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X2 [Solanum tuberosum] gi|565356900|ref|XP_006345298.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X3 [Solanum tuberosum] Length = 997 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVMG-DERVIYQAALQNISQPDGELDVP 177 +LP +L KA S YT ++DP G E+R DER+I+QAALQ+++QP E +P Sbjct: 197 VLPPSLMHRKATSGVQYTSVNDPLHYPGTAEERAAAADERLIFQAALQDLNQPKVEARLP 256 Query: 178 KGVLTVPL 201 +G+L+V L Sbjct: 257 EGLLSVSL 264 >ref|XP_006406428.1| hypothetical protein EUTSA_v10020061mg [Eutrema salsugineum] gi|557107574|gb|ESQ47881.1| hypothetical protein EUTSA_v10020061mg [Eutrema salsugineum] Length = 841 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVM-GDERVIYQAALQNISQPDGELDVP 177 ILP ++A G + S + SDP +G DR DER+IYQAALQ+++QP E+D+ Sbjct: 6 ILPPSMAHGTSASPLHFAGSSDPMHRIGISGDRNSENDERLIYQAALQDLNQPRTEMDLC 65 Query: 178 KGVLTVPL 201 G L+VPL Sbjct: 66 PGTLSVPL 73 >gb|EOX99038.1| SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related isoform 4 [Theobroma cacao] Length = 981 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRV-MGDERVIYQAALQNISQPDGELDVP 177 ILP + GK+ + + + DP G E+RV + DER+IYQAAL++++QP E +P Sbjct: 208 ILPPSFMHGKSVTYTQFAGLDDPVYRAGVSEERVPVNDERMIYQAALEDLNQPKVEATLP 267 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 268 DGLLSVPL 275 >gb|EOX99037.1| SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related isoform 3 [Theobroma cacao] Length = 1032 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRV-MGDERVIYQAALQNISQPDGELDVP 177 ILP + GK+ + + + DP G E+RV + DER+IYQAAL++++QP E +P Sbjct: 208 ILPPSFMHGKSVTYTQFAGLDDPVYRAGVSEERVPVNDERMIYQAALEDLNQPKVEATLP 267 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 268 DGLLSVPL 275 >gb|EOX99036.1| SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related isoform 2 [Theobroma cacao] Length = 1007 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRV-MGDERVIYQAALQNISQPDGELDVP 177 ILP + GK+ + + + DP G E+RV + DER+IYQAAL++++QP E +P Sbjct: 208 ILPPSFMHGKSVTYTQFAGLDDPVYRAGVSEERVPVNDERMIYQAALEDLNQPKVEATLP 267 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 268 DGLLSVPL 275 >gb|EOX99035.1| SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related isoform 1 [Theobroma cacao] Length = 1117 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/68 (42%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRV-MGDERVIYQAALQNISQPDGELDVP 177 ILP + GK+ + + + DP G E+RV + DER+IYQAAL++++QP E +P Sbjct: 269 ILPPSFMHGKSVTYTQFAGLDDPVYRAGVSEERVPVNDERMIYQAALEDLNQPKVEATLP 328 Query: 178 KGVLTVPL 201 G+L+VPL Sbjct: 329 DGLLSVPL 336 >ref|XP_004231724.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like [Solanum lycopersicum] Length = 997 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/68 (44%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = +1 Query: 1 ILPHTLARGKAGSSADYTIISDPYQNMGFGEDRVMG-DERVIYQAALQNISQPDGELDVP 177 +LP +L KA S YT ++DP G E+R DER+I+QAALQ+++QP E +P Sbjct: 197 VLPPSLMHRKATSGVQYTSVNDPLHYPGTAEERAAAADERLIFQAALQDLNQPKVEARLP 256 Query: 178 KGVLTVPL 201 +G+L+V L Sbjct: 257 EGLLSVSL 264 >ref|XP_002513133.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223548144|gb|EEF49636.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 993 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = +1 Query: 4 LPHTLARGKAGSSADYTIISDPYQNMGFGEDRVMG-DERVIYQAALQNISQPDGELDVPK 180 LP +L RGK+ SA + + + M GE+ V G DER+IYQAAL++++QP E +P Sbjct: 198 LPPSLMRGKSTPSAQFGLRDPAFHPMA-GEEGVAGSDERLIYQAALEDLNQPKVEATLPD 256 Query: 181 GVLTVPL 201 G+L+VPL Sbjct: 257 GLLSVPL 263