BLASTX nr result
ID: Achyranthes23_contig00031429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00031429 (273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_175104.1| ethylene-responsive transcription factor ERF014... 78 1e-12 dbj|BAD43266.1| putative transcription factor [Arabidopsis thali... 78 1e-12 ref|XP_002891298.1| hypothetical protein ARALYDRAFT_473823 [Arab... 78 1e-12 ref|XP_002513787.1| Transcriptional factor TINY, putative [Ricin... 78 1e-12 ref|XP_006393702.1| hypothetical protein EUTSA_v10011778mg [Eutr... 78 1e-12 ref|XP_006304191.1| hypothetical protein CARUB_v10010259mg [Caps... 78 1e-12 ref|XP_004514952.1| PREDICTED: ethylene-responsive transcription... 77 2e-12 gb|EMJ25002.1| hypothetical protein PRUPE_ppa010649mg [Prunus pe... 77 3e-12 ref|XP_006472752.1| PREDICTED: ethylene-responsive transcription... 76 4e-12 ref|XP_006434157.1| hypothetical protein CICLE_v10002294mg [Citr... 76 4e-12 gb|EOY16238.1| Integrase-type DNA-binding superfamily protein, p... 76 4e-12 ref|XP_003634463.1| PREDICTED: ethylene-responsive transcription... 76 4e-12 emb|CAN68007.1| hypothetical protein VITISV_014949 [Vitis vinifera] 76 4e-12 ref|NP_173609.1| ethylene-responsive transcription factor ERF012... 75 7e-12 ref|XP_003601066.1| AP2 domain-containing transcription factor [... 75 7e-12 ref|XP_002890471.1| AP2 domain-containing transcription factor f... 75 7e-12 ref|NP_001239623.1| ethylene-responsive transcription factor ERF... 75 7e-12 ref|NP_001241199.1| ethylene-responsive transcription factor ERF... 75 7e-12 gb|AAM63137.1| TINY-like protein [Arabidopsis thaliana] 75 7e-12 gb|ESW09383.1| hypothetical protein PHAVU_009G123300g [Phaseolus... 75 9e-12 >ref|NP_175104.1| ethylene-responsive transcription factor ERF014 [Arabidopsis thaliana] gi|75264120|sp|Q9LPE8.1|ERF14_ARATH RecName: Full=Ethylene-responsive transcription factor ERF014 gi|8655993|gb|AAF78266.1|AC020576_10 Contains similarity to RAP2.10 protein from Arabidopsis thaliana gb|AF003103 and contains an AP2 PF|00847 domain [Arabidopsis thaliana] gi|48479270|gb|AAT44906.1| putative AP2/EREBP transcription factor [Arabidopsis thaliana] gi|94442471|gb|ABF19023.1| At1g44830 [Arabidopsis thaliana] gi|332193935|gb|AEE32056.1| Integrase-type DNA-binding superfamily protein [Arabidopsis thaliana] Length = 211 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 26 SSSSIRMKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 66 >dbj|BAD43266.1| putative transcription factor [Arabidopsis thaliana] Length = 201 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 16 SSSSIRMKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 56 >ref|XP_002891298.1| hypothetical protein ARALYDRAFT_473823 [Arabidopsis lyrata subsp. lyrata] gi|297337140|gb|EFH67557.1| hypothetical protein ARALYDRAFT_473823 [Arabidopsis lyrata subsp. lyrata] Length = 211 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 26 SSSSIRMKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 66 >ref|XP_002513787.1| Transcriptional factor TINY, putative [Ricinus communis] gi|223546873|gb|EEF48370.1| Transcriptional factor TINY, putative [Ricinus communis] Length = 230 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +3 Query: 141 TQLSQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 T S ++S KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 19 TSPSSSASTKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 62 >ref|XP_006393702.1| hypothetical protein EUTSA_v10011778mg [Eutrema salsugineum] gi|557090280|gb|ESQ30988.1| hypothetical protein EUTSA_v10011778mg [Eutrema salsugineum] Length = 209 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +3 Query: 141 TQLSQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 T S+++KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 26 TSSISKSNMIKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 69 >ref|XP_006304191.1| hypothetical protein CARUB_v10010259mg [Capsella rubella] gi|482572902|gb|EOA37089.1| hypothetical protein CARUB_v10010259mg [Capsella rubella] Length = 218 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S + +MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 30 SSSIRMMKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 70 >ref|XP_004514952.1| PREDICTED: ethylene-responsive transcription factor ERF014-like [Cicer arietinum] Length = 252 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +3 Query: 141 TQLSQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 +++S ++ KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 26 SEISASNEKKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 69 >gb|EMJ25002.1| hypothetical protein PRUPE_ppa010649mg [Prunus persica] Length = 241 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +3 Query: 141 TQLSQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 T S ++ KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 25 TSASSSACKKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 68 >ref|XP_006472752.1| PREDICTED: ethylene-responsive transcription factor ERF014-like [Citrus sinensis] Length = 246 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 168 MKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 42 MKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 76 >ref|XP_006434157.1| hypothetical protein CICLE_v10002294mg [Citrus clementina] gi|557536279|gb|ESR47397.1| hypothetical protein CICLE_v10002294mg [Citrus clementina] Length = 244 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +3 Query: 168 MKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 MKKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 40 MKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 74 >gb|EOY16238.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 216 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 24 SSSSCKKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 64 >ref|XP_003634463.1| PREDICTED: ethylene-responsive transcription factor ERF012-like [Vitis vinifera] Length = 233 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 27 SSSSCRKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 67 >emb|CAN68007.1| hypothetical protein VITISV_014949 [Vitis vinifera] Length = 610 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +S KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 27 SSSSCRKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 67 >ref|NP_173609.1| ethylene-responsive transcription factor ERF012 [Arabidopsis thaliana] gi|75265793|sp|Q9SFE4.1|ERF12_ARATH RecName: Full=Ethylene-responsive transcription factor ERF012 gi|6552733|gb|AAF16532.1|AC013482_6 T26F17.14 [Arabidopsis thaliana] gi|51971555|dbj|BAD44442.1| TINY like protein [Arabidopsis thaliana] gi|88196743|gb|ABD43014.1| At1g21910 [Arabidopsis thaliana] gi|332192050|gb|AEE30171.1| ethylene-responsive transcription factor ERF012 [Arabidopsis thaliana] Length = 230 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 162 SLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 45 SKIKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 81 >ref|XP_003601066.1| AP2 domain-containing transcription factor [Medicago truncatula] gi|355490114|gb|AES71317.1| AP2 domain-containing transcription factor [Medicago truncatula] gi|388516979|gb|AFK46551.1| unknown [Medicago truncatula] Length = 220 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S + S KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 16 SISDSSKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 56 >ref|XP_002890471.1| AP2 domain-containing transcription factor family protein [Arabidopsis lyrata subsp. lyrata] gi|297336313|gb|EFH66730.1| AP2 domain-containing transcription factor family protein [Arabidopsis lyrata subsp. lyrata] Length = 229 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 162 SLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 44 SKIKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 80 >ref|NP_001239623.1| ethylene-responsive transcription factor ERF012-like [Glycine max] gi|212717194|gb|ACJ37438.1| AP2 domain-containing transcription factor 4 [Glycine max] Length = 245 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S + + KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 26 SSSDNKKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 66 >ref|NP_001241199.1| ethylene-responsive transcription factor ERF012-like [Glycine max] gi|212717192|gb|ACJ37437.1| AP2 domain-containing transcription factor 3 [Glycine max] Length = 246 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 156 NSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 N+ KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 18 NNKNKKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 56 >gb|AAM63137.1| TINY-like protein [Arabidopsis thaliana] Length = 231 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 162 SLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S +KKYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 46 SKIKKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 82 >gb|ESW09383.1| hypothetical protein PHAVU_009G123300g [Phaseolus vulgaris] Length = 235 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 150 SQNSSLMKKYKGVRMRSWGSWVSEIRAPTQKTRIWLGSYST 272 S + S +KYKGVRMRSWGSWVSEIRAP QKTRIWLGSYST Sbjct: 32 SASDSKKRKYKGVRMRSWGSWVSEIRAPNQKTRIWLGSYST 72