BLASTX nr result
ID: Achyranthes23_contig00031099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00031099 (216 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136618.1| PREDICTED: uncharacterized protein LOC101214... 64 3e-08 emb|CBI29841.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002284060.1| PREDICTED: uncharacterized protein LOC100264... 59 7e-07 emb|CAN82225.1| hypothetical protein VITISV_011873 [Vitis vinifera] 59 7e-07 ref|XP_002323318.2| hypothetical protein POPTR_0016s05600g [Popu... 56 6e-06 >ref|XP_004136618.1| PREDICTED: uncharacterized protein LOC101214137 [Cucumis sativus] gi|449523175|ref|XP_004168600.1| PREDICTED: uncharacterized protein LOC101224948 [Cucumis sativus] Length = 762 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = +3 Query: 15 MLVQDRIPTKGSAQNPTNLPKSQVRNLPTLHPNRFSESKSLDFSTWVSENLYK 173 MLVQ+R K PK+Q+R LPTLH +RFSESKSLDFSTW+S+N+Y+ Sbjct: 1 MLVQERSTPKS--------PKTQIRTLPTLHSHRFSESKSLDFSTWLSDNVYR 45 >emb|CBI29841.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 15 MLVQDRIPTKGSAQNPTNLPKSQVRNLPTLHPNRFSESKSLDFSTWVSENLYK 173 MLVQDR K PK+ +R L +LHP+RF+E K+LDFSTW SENLYK Sbjct: 1 MLVQDRSTPKS--------PKTHIRALHSLHPDRFTEPKNLDFSTWFSENLYK 45 >ref|XP_002284060.1| PREDICTED: uncharacterized protein LOC100264133 [Vitis vinifera] Length = 762 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 15 MLVQDRIPTKGSAQNPTNLPKSQVRNLPTLHPNRFSESKSLDFSTWVSENLYK 173 MLVQDR K PK+ +R L +LHP+RF+E K+LDFSTW SENLYK Sbjct: 1 MLVQDRSTPKS--------PKTHIRALHSLHPDRFTEPKNLDFSTWFSENLYK 45 >emb|CAN82225.1| hypothetical protein VITISV_011873 [Vitis vinifera] Length = 762 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = +3 Query: 15 MLVQDRIPTKGSAQNPTNLPKSQVRNLPTLHPNRFSESKSLDFSTWVSENLYK 173 MLVQDR K PK+ +R L +LHP+RF+E K+LDFSTW SENLYK Sbjct: 1 MLVQDRSTPKS--------PKTHIRALHSLHPDRFTEPKNLDFSTWFSENLYK 45 >ref|XP_002323318.2| hypothetical protein POPTR_0016s05600g [Populus trichocarpa] gi|550320908|gb|EEF05079.2| hypothetical protein POPTR_0016s05600g [Populus trichocarpa] Length = 771 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 6/59 (10%) Frame = +3 Query: 15 MLVQDRIPTKGSAQNPTNLPKSQVRNLPTLHPN------RFSESKSLDFSTWVSENLYK 173 MLVQ R+ T NP + PKSQ+R PT++ N RFSESKSLDFSTWVSEN YK Sbjct: 1 MLVQGRVTTN---PNPKS-PKSQIR--PTINHNHHDLHQRFSESKSLDFSTWVSENFYK 53