BLASTX nr result
ID: Achyranthes23_contig00030643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00030643 (605 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA29116.1| putative MYB transcription factor [Rosa hybrid c... 64 4e-08 gb|EMJ19341.1| hypothetical protein PRUPE_ppa007268mg [Prunus pe... 61 3e-07 ref|XP_004306804.1| PREDICTED: uncharacterized protein LOC101307... 59 8e-07 >emb|CCA29116.1| putative MYB transcription factor [Rosa hybrid cultivar] Length = 329 Score = 63.5 bits (153), Expect = 4e-08 Identities = 32/63 (50%), Positives = 45/63 (71%) Frame = +2 Query: 113 EDTMYKPVIKTEIVDTNARSDSSRSNEMDD*SESAFELLLDFPGNNDMSFLQDPIHDYTI 292 ED +Y+ + K+ + SDSS SN++DD SESA +LLLD+P NNDMSFL+D ++DY Sbjct: 257 EDMVYR-IYKSNTENVTRGSDSSSSNKLDDSSESAMDLLLDYPINNDMSFLEDDMNDYAT 315 Query: 293 FSS 301 +S Sbjct: 316 STS 318 >gb|EMJ19341.1| hypothetical protein PRUPE_ppa007268mg [Prunus persica] Length = 375 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = +2 Query: 113 EDTMYKPVIKTEIVDTNARSDSSRSNEMDD*SESAFELLLDFPGNNDMSFLQDPIHDYTI 292 ED YKP + D A SDSS SN+++D S++A +LLL+FP NNDMSFL+D + DY Sbjct: 303 EDVEYKPW-RLNTKDVMAGSDSSCSNDLEDSSDTALQLLLNFPINNDMSFLEDNVDDYAT 361 Query: 293 FSSEMNP 313 + P Sbjct: 362 TPARWTP 368 >ref|XP_004306804.1| PREDICTED: uncharacterized protein LOC101307334 [Fragaria vesca subsp. vesca] Length = 340 Score = 59.3 bits (142), Expect = 8e-07 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (1%) Frame = +2 Query: 113 EDTMYKPVIKTEIVDTNAR-SDSSRSNEMDD*SESAFELLLDFPGNNDMSFLQDPIHDYT 289 ED +Y+ + K + R SDSS SN++DD SESA ++LLD+P NNDMSFL+D ++DY Sbjct: 257 EDMIYR-IYKCNTENVMIRGSDSSSSNKLDDSSESAMDMLLDYPINNDMSFLEDDMNDYA 315 Query: 290 IFSS 301 +S Sbjct: 316 TSTS 319