BLASTX nr result
ID: Achyranthes23_contig00030451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00030451 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004487331.1| PREDICTED: vesicle-associated protein 4-2-li... 65 9e-09 ref|XP_004487330.1| PREDICTED: vesicle-associated protein 4-2-li... 65 9e-09 gb|AFK47411.1| unknown [Medicago truncatula] 65 9e-09 gb|AFK42406.1| unknown [Medicago truncatula] 65 9e-09 gb|AFK40274.1| unknown [Medicago truncatula] 65 9e-09 gb|ACJ85389.1| unknown [Medicago truncatula] 65 9e-09 gb|AFK39696.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_006593058.1| PREDICTED: vesicle-associated protein 4-2-li... 64 3e-08 ref|XP_004487652.1| PREDICTED: vesicle-associated protein 4-1-li... 64 3e-08 ref|XP_003527459.1| PREDICTED: vesicle-associated protein 4-2-li... 64 3e-08 gb|ACU23748.1| unknown [Glycine max] 64 3e-08 ref|XP_003540343.1| PREDICTED: vesicle-associated protein 4-2-li... 63 5e-08 gb|ESW04621.1| hypothetical protein PHAVU_011G111000g [Phaseolus... 62 1e-07 ref|XP_002517996.1| structural molecule, putative [Ricinus commu... 62 1e-07 gb|EOX99305.1| Vesicle-associated protein 4-2 [Theobroma cacao] 61 1e-07 ref|XP_002525767.1| structural molecule, putative [Ricinus commu... 61 1e-07 gb|ESW21638.1| hypothetical protein PHAVU_005G086900g [Phaseolus... 61 2e-07 ref|XP_004294476.1| PREDICTED: vesicle-associated protein 4-2-li... 61 2e-07 gb|EMJ13076.1| hypothetical protein PRUPE_ppa010173mg [Prunus pe... 61 2e-07 ref|XP_003543271.1| PREDICTED: vesicle-associated protein 4-1-li... 61 2e-07 >ref|XP_004487331.1| PREDICTED: vesicle-associated protein 4-2-like isoform X2 [Cicer arietinum] Length = 272 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 65 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 100 >ref|XP_004487330.1| PREDICTED: vesicle-associated protein 4-2-like isoform X1 [Cicer arietinum] Length = 279 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 65 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 100 >gb|AFK47411.1| unknown [Medicago truncatula] Length = 252 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 44 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 79 >gb|AFK42406.1| unknown [Medicago truncatula] Length = 162 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 20 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 55 >gb|AFK40274.1| unknown [Medicago truncatula] Length = 271 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 63 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 98 >gb|ACJ85389.1| unknown [Medicago truncatula] Length = 271 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 63 QSSATVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 98 >gb|AFK39696.1| unknown [Lotus japonicus] Length = 266 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 ++ PTVSSVAKSLLP +RRLRLDP N LYFPYEPGK Sbjct: 60 QASPTVSSVAKSLLPTRRRLRLDPSNKLYFPYEPGK 95 >ref|XP_006593058.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] Length = 298 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 321 TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 63 TVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 94 >ref|XP_004487652.1| PREDICTED: vesicle-associated protein 4-1-like [Cicer arietinum] Length = 243 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +S TVSSVA+SLLP +RRLRLDP NHLYFPYEPGK Sbjct: 37 KSSKTVSSVARSLLPHRRRLRLDPSNHLYFPYEPGK 72 >ref|XP_003527459.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] Length = 271 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 321 TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 69 TVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 100 >gb|ACU23748.1| unknown [Glycine max] Length = 265 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 321 TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 TVSSVAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 63 TVSSVAKSLLPTRRRLRLDPPNKLYFPYEPGK 94 >ref|XP_003540343.1| PREDICTED: vesicle-associated protein 4-2-like [Glycine max] Length = 263 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 312 SKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 S TVSSVAKSLLP KRRLRLDP N LYFPYEPGK Sbjct: 58 SSTTVSSVAKSLLPTKRRLRLDPSNKLYFPYEPGK 92 >gb|ESW04621.1| hypothetical protein PHAVU_011G111000g [Phaseolus vulgaris] Length = 264 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +3 Query: 321 TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 TVSSVAKSLLP +RRLRLDPP+ LYFPYEPGK Sbjct: 62 TVSSVAKSLLPTRRRLRLDPPSKLYFPYEPGK 93 >ref|XP_002517996.1| structural molecule, putative [Ricinus communis] gi|223542978|gb|EEF44514.1| structural molecule, putative [Ricinus communis] Length = 234 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 312 SKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 S TVS VAKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 30 STNTVSLVAKSLLPTRRRLRLDPPNKLYFPYEPGK 64 >gb|EOX99305.1| Vesicle-associated protein 4-2 [Theobroma cacao] Length = 270 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 312 SKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 S VSS+AKSLLP +RRLRLDPPN LYFPYEPGK Sbjct: 65 SSNAVSSMAKSLLPTRRRLRLDPPNKLYFPYEPGK 99 >ref|XP_002525767.1| structural molecule, putative [Ricinus communis] gi|223534917|gb|EEF36603.1| structural molecule, putative [Ricinus communis] Length = 126 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 312 SKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 S TVSSVA+SLLP +RRLRLDP N+LYFPYEPGK Sbjct: 66 SSKTVSSVARSLLPARRRLRLDPSNNLYFPYEPGK 100 >gb|ESW21638.1| hypothetical protein PHAVU_005G086900g [Phaseolus vulgaris] Length = 246 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 309 RSKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 RS TVSSVA+SLLP +RRLRLDP ++LYFPYEPGK Sbjct: 40 RSSKTVSSVARSLLPPRRRLRLDPSSYLYFPYEPGK 75 >ref|XP_004294476.1| PREDICTED: vesicle-associated protein 4-2-like [Fragaria vesca subsp. vesca] Length = 267 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 309 RSKP-TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +SKP TVSSVA+SLLP +RRLRLDP N LYFPYEPGK Sbjct: 60 KSKPKTVSSVARSLLPPRRRLRLDPANKLYFPYEPGK 96 >gb|EMJ13076.1| hypothetical protein PRUPE_ppa010173mg [Prunus persica] Length = 260 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = +3 Query: 309 RSKP-TVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 +SKP TVSSVA+SLLP +RRLRLDP N LYFPYEPGK Sbjct: 53 KSKPKTVSSVARSLLPPRRRLRLDPANKLYFPYEPGK 89 >ref|XP_003543271.1| PREDICTED: vesicle-associated protein 4-1-like [Glycine max] Length = 240 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 312 SKPTVSSVAKSLLPVKRRLRLDPPNHLYFPYEPGK 416 S TVSSVA+SLLP +RRLRLDP N+LYFPYEPGK Sbjct: 35 SSKTVSSVARSLLPPRRRLRLDPSNYLYFPYEPGK 69