BLASTX nr result
ID: Achyranthes23_contig00030031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00030031 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitoch... 73 5e-11 ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycin... 71 1e-10 ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycin... 71 1e-10 gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] 70 4e-10 ref|XP_004299576.1| PREDICTED: 39S ribosomal protein L47, mitoch... 70 4e-10 ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitoch... 70 4e-10 gb|ESW10194.1| hypothetical protein PHAVU_009G188900g [Phaseolus... 69 7e-10 ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] g... 69 9e-10 gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indi... 69 9e-10 ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitoch... 68 1e-09 ref|XP_006345029.1| PREDICTED: 39S ribosomal protein L47, mitoch... 68 1e-09 ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citr... 68 1e-09 ref|XP_004500483.1| PREDICTED: 39S ribosomal protein L47, mitoch... 68 1e-09 ref|XP_004491551.1| PREDICTED: 39S ribosomal protein L47, mitoch... 68 1e-09 gb|EMJ10949.1| hypothetical protein PRUPE_ppa013066mg [Prunus pe... 68 1e-09 ref|XP_004236129.1| PREDICTED: 39S ribosomal protein L47, mitoch... 68 1e-09 ref|XP_002320251.1| ribosomal protein L29 [Populus trichocarpa] ... 68 1e-09 ref|XP_006840519.1| hypothetical protein AMTR_s00045p00206320 [A... 68 1e-09 ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutr... 67 2e-09 ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Caps... 67 2e-09 >ref|XP_004138121.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] gi|449528917|ref|XP_004171448.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cucumis sativus] Length = 143 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL Sbjct: 109 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 143 >ref|NP_001241009.1| uncharacterized protein LOC100812176 [Glycine max] gi|255640572|gb|ACU20571.1| unknown [Glycine max] Length = 143 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRRSAEMKRMINAL Sbjct: 109 VRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINAL 143 >ref|NP_001238505.1| uncharacterized protein LOC100500208 [Glycine max] gi|255629706|gb|ACU15202.1| unknown [Glycine max] Length = 142 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRRSAEMKRMINAL Sbjct: 108 VRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINAL 142 >gb|EXC31172.1| 39S ribosomal protein L47 [Morus notabilis] Length = 143 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRRSAEMKRMIN L Sbjct: 109 VRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINVL 143 >ref|XP_004299576.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 140 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAIDEPD RRSAEMKRMINAL Sbjct: 106 VRKSMCRIKHVLTERAIDEPDSRRSAEMKRMINAL 140 >ref|XP_002283452.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 1 [Vitis vinifera] gi|225457112|ref|XP_002283459.1| PREDICTED: 39S ribosomal protein L47, mitochondrial isoform 2 [Vitis vinifera] gi|297733826|emb|CBI15073.3| unnamed protein product [Vitis vinifera] Length = 140 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRRS EMKRMINAL Sbjct: 106 VRKSMCRIKHVLTERAIEEPDPRRSVEMKRMINAL 140 >gb|ESW10194.1| hypothetical protein PHAVU_009G188900g [Phaseolus vulgaris] Length = 142 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRRSA+MK+MINAL Sbjct: 108 VRKSMCRIKHVLTERAIEEPDPRRSADMKKMINAL 142 >ref|NP_001056673.1| Os06g0128500 [Oryza sativa Japonica Group] gi|52075615|dbj|BAD44786.1| ribosomal protein L29 protein-like [Oryza sativa Japonica Group] gi|113594713|dbj|BAF18587.1| Os06g0128500 [Oryza sativa Japonica Group] gi|215765035|dbj|BAG86732.1| unnamed protein product [Oryza sativa Japonica Group] gi|215768582|dbj|BAH00811.1| unnamed protein product [Oryza sativa Japonica Group] Length = 145 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 V+KSMCRIKHVLTERAI EPDPRRSAEMKRMINAL Sbjct: 111 VKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINAL 145 >gb|EEC79917.1| hypothetical protein OsI_21467 [Oryza sativa Indica Group] gi|222634889|gb|EEE65021.1| hypothetical protein OsJ_19975 [Oryza sativa Japonica Group] Length = 291 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 V+KSMCRIKHVLTERAI EPDPRRSAEMKRMINAL Sbjct: 257 VKKSMCRIKHVLTERAIAEPDPRRSAEMKRMINAL 291 >ref|XP_006476735.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Citrus sinensis] Length = 143 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIK VLTERAI+EPDPRRSAEMKRMINAL Sbjct: 109 VRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINAL 143 >ref|XP_006345029.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Solanum tuberosum] Length = 142 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAIDE DPRRS EMKRMINAL Sbjct: 108 VRKSMCRIKHVLTERAIDEADPRRSTEMKRMINAL 142 >ref|XP_006439758.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] gi|557542020|gb|ESR52998.1| hypothetical protein CICLE_v10022742mg [Citrus clementina] Length = 143 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIK VLTERAI+EPDPRRSAEMKRMINAL Sbjct: 109 VRKSMCRIKQVLTERAIEEPDPRRSAEMKRMINAL 143 >ref|XP_004500483.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cicer arietinum] Length = 143 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPD RRSAEMKRMINAL Sbjct: 109 VRKSMCRIKHVLTERAIEEPDARRSAEMKRMINAL 143 >ref|XP_004491551.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like [Cicer arietinum] Length = 144 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPD RRSAEMKRMINAL Sbjct: 110 VRKSMCRIKHVLTERAIEEPDARRSAEMKRMINAL 144 >gb|EMJ10949.1| hypothetical protein PRUPE_ppa013066mg [Prunus persica] Length = 141 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPDPRR AEMK+MINAL Sbjct: 107 VRKSMCRIKHVLTERAIEEPDPRRCAEMKKMINAL 141 >ref|XP_004236129.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like isoform 1 [Solanum lycopersicum] gi|460380776|ref|XP_004236130.1| PREDICTED: 39S ribosomal protein L47, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 138 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAIDE DPRRS EMKRMINAL Sbjct: 104 VRKSMCRIKHVLTERAIDEADPRRSTEMKRMINAL 138 >ref|XP_002320251.1| ribosomal protein L29 [Populus trichocarpa] gi|118483659|gb|ABK93723.1| unknown [Populus trichocarpa] gi|222861024|gb|EEE98566.1| ribosomal protein L29 [Populus trichocarpa] Length = 142 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERAI+EPD RRSAEMKRMINAL Sbjct: 108 VRKSMCRIKHVLTERAIEEPDSRRSAEMKRMINAL 142 >ref|XP_006840519.1| hypothetical protein AMTR_s00045p00206320 [Amborella trichopoda] gi|548842237|gb|ERN02194.1| hypothetical protein AMTR_s00045p00206320 [Amborella trichopoda] Length = 139 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VRKSMCRIKHVLTERA+ EPDPRRSAEMKR+INAL Sbjct: 105 VRKSMCRIKHVLTERAMQEPDPRRSAEMKRIINAL 139 >ref|XP_006417761.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] gi|557095532|gb|ESQ36114.1| hypothetical protein EUTSA_v10009035mg [Eutrema salsugineum] Length = 144 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VR+SMCRIKHVLTERAI+EPDPRRSAEMKRM+N + Sbjct: 110 VRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVNGM 144 >ref|XP_006292012.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|565468266|ref|XP_006292013.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560719|gb|EOA24910.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] gi|482560720|gb|EOA24911.1| hypothetical protein CARUB_v10018201mg [Capsella rubella] Length = 144 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 380 VRKSMCRIKHVLTERAIDEPDPRRSAEMKRMINAL 276 VR+SMCRIKHVLTERAI+EPDPRRSAEMKRM+N + Sbjct: 110 VRRSMCRIKHVLTERAIEEPDPRRSAEMKRMVNGM 144