BLASTX nr result
ID: Achyranthes23_contig00029677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029677 (897 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC01942.1| hypothetical protein L484_018856 [Morus notabilis] 75 3e-11 ref|XP_006577091.1| PREDICTED: uncharacterized protein LOC100788... 75 3e-11 gb|ESW34942.1| hypothetical protein PHAVU_001G193700g [Phaseolus... 75 3e-11 ref|XP_006430106.1| hypothetical protein CICLE_v10013147mg [Citr... 75 3e-11 gb|AGV54191.1| hypothetical protein [Phaseolus vulgaris] 75 3e-11 gb|EOY08413.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] gi|5087... 75 3e-11 ref|XP_003554456.1| PREDICTED: uncharacterized protein LOC100805... 75 3e-11 ref|XP_003521482.1| PREDICTED: uncharacterized protein LOC100788... 75 3e-11 ref|XP_002281204.1| PREDICTED: uncharacterized protein LOC100266... 75 3e-11 emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] 75 3e-11 gb|EMJ05697.1| hypothetical protein PRUPE_ppa019371mg, partial [... 75 4e-11 ref|XP_006399095.1| hypothetical protein EUTSA_v10015029mg [Eutr... 74 1e-10 ref|XP_004497684.1| PREDICTED: uncharacterized protein LOC101512... 74 1e-10 ref|XP_004303512.1| PREDICTED: uncharacterized protein LOC101314... 74 1e-10 ref|NP_196245.1| uncharacterized protein [Arabidopsis thaliana] ... 74 1e-10 ref|XP_002871209.1| hypothetical protein ARALYDRAFT_487435 [Arab... 74 1e-10 ref|XP_002530166.1| conserved hypothetical protein [Ricinus comm... 74 1e-10 ref|XP_002309400.2| hypothetical protein POPTR_0006s22230g [Popu... 73 1e-10 ref|XP_006854724.1| hypothetical protein AMTR_s00030p00238280 [A... 73 2e-10 ref|XP_006296745.1| hypothetical protein CARUB_v10014943mg [Caps... 73 2e-10 >gb|EXC01942.1| hypothetical protein L484_018856 [Morus notabilis] Length = 115 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 70 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 102 >ref|XP_006577091.1| PREDICTED: uncharacterized protein LOC100788969 isoform X2 [Glycine max] Length = 119 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 78 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 110 >gb|ESW34942.1| hypothetical protein PHAVU_001G193700g [Phaseolus vulgaris] Length = 152 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 111 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 143 >ref|XP_006430106.1| hypothetical protein CICLE_v10013147mg [Citrus clementina] gi|557532163|gb|ESR43346.1| hypothetical protein CICLE_v10013147mg [Citrus clementina] Length = 115 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 68 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 100 >gb|AGV54191.1| hypothetical protein [Phaseolus vulgaris] Length = 109 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 68 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 100 >gb|EOY08413.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] gi|508716517|gb|EOY08414.1| Gb:AAF02129.1 isoform 1 [Theobroma cacao] Length = 113 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 69 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 101 >ref|XP_003554456.1| PREDICTED: uncharacterized protein LOC100805043 [Glycine max] Length = 109 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 68 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 100 >ref|XP_003521482.1| PREDICTED: uncharacterized protein LOC100788969 isoform X1 [Glycine max] Length = 109 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 68 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 100 >ref|XP_002281204.1| PREDICTED: uncharacterized protein LOC100266492 [Vitis vinifera] Length = 120 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 67 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 99 >emb|CAN79170.1| hypothetical protein VITISV_012166 [Vitis vinifera] Length = 281 Score = 75.1 bits (183), Expect = 3e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 228 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHD 260 >gb|EMJ05697.1| hypothetical protein PRUPE_ppa019371mg, partial [Prunus persica] Length = 132 Score = 74.7 bits (182), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+HD Sbjct: 84 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFVHD 116 >ref|XP_006399095.1| hypothetical protein EUTSA_v10015029mg [Eutrema salsugineum] gi|567170956|ref|XP_006399096.1| hypothetical protein EUTSA_v10015029mg [Eutrema salsugineum] gi|557100185|gb|ESQ40548.1| hypothetical protein EUTSA_v10015029mg [Eutrema salsugineum] gi|557100186|gb|ESQ40549.1| hypothetical protein EUTSA_v10015029mg [Eutrema salsugineum] Length = 123 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 69 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 101 >ref|XP_004497684.1| PREDICTED: uncharacterized protein LOC101512833 [Cicer arietinum] Length = 119 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 76 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 108 >ref|XP_004303512.1| PREDICTED: uncharacterized protein LOC101314295 [Fragaria vesca subsp. vesca] Length = 113 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 71 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 103 >ref|NP_196245.1| uncharacterized protein [Arabidopsis thaliana] gi|9758407|dbj|BAB08949.1| unnamed protein product [Arabidopsis thaliana] gi|21536580|gb|AAM60912.1| unknown [Arabidopsis thaliana] gi|28392887|gb|AAO41880.1| putative B-type cyclin [Arabidopsis thaliana] gi|28827636|gb|AAO50662.1| putative B-type cyclin [Arabidopsis thaliana] gi|332003613|gb|AED90996.1| uncharacterized protein AT5G06270 [Arabidopsis thaliana] Length = 122 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 69 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 101 >ref|XP_002871209.1| hypothetical protein ARALYDRAFT_487435 [Arabidopsis lyrata subsp. lyrata] gi|297317046|gb|EFH47468.1| hypothetical protein ARALYDRAFT_487435 [Arabidopsis lyrata subsp. lyrata] Length = 120 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 69 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 101 >ref|XP_002530166.1| conserved hypothetical protein [Ricinus communis] gi|223530327|gb|EEF32221.1| conserved hypothetical protein [Ricinus communis] Length = 195 Score = 73.6 bits (179), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H+ Sbjct: 155 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHE 187 >ref|XP_002309400.2| hypothetical protein POPTR_0006s22230g [Populus trichocarpa] gi|550336847|gb|EEE92923.2| hypothetical protein POPTR_0006s22230g [Populus trichocarpa] Length = 113 Score = 73.2 bits (178), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSE+DP+CPKCKSTVLLDF+HD Sbjct: 69 VGCPRCLMYVMLSENDPKCPKCKSTVLLDFLHD 101 >ref|XP_006854724.1| hypothetical protein AMTR_s00030p00238280 [Amborella trichopoda] gi|548858410|gb|ERN16191.1| hypothetical protein AMTR_s00030p00238280 [Amborella trichopoda] Length = 208 Score = 72.8 bits (177), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMHD 329 VGCPRCLMYVMLSE DP+CPKCKSTVLLDF+HD Sbjct: 170 VGCPRCLMYVMLSEQDPKCPKCKSTVLLDFLHD 202 >ref|XP_006296745.1| hypothetical protein CARUB_v10014943mg [Capsella rubella] gi|482565454|gb|EOA29643.1| hypothetical protein CARUB_v10014943mg [Capsella rubella] Length = 119 Score = 72.8 bits (177), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 427 VGCPRCLMYVMLSEDDPRCPKCKSTVLLDFMH 332 VGCPRCLMYVMLSEDDP+CPKCKSTVLLDF+H Sbjct: 65 VGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLH 96