BLASTX nr result
ID: Achyranthes23_contig00029590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029590 (276 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444749.1| hypothetical protein CICLE_v10019672mg [Citr... 65 7e-09 ref|XP_006444748.1| hypothetical protein CICLE_v10019672mg [Citr... 65 7e-09 ref|XP_006375382.1| hypothetical protein POPTR_0014s10010g [Popu... 64 3e-08 ref|XP_002529975.1| acyltransferase, putative [Ricinus communis]... 64 3e-08 gb|EMJ20182.1| hypothetical protein PRUPE_ppa003977mg [Prunus pe... 61 2e-07 emb|CBI38700.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002264721.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [V... 60 2e-07 gb|EXB83831.1| 3-ketoacyl-CoA synthase 1 [Morus notabilis] 60 3e-07 gb|AGK29993.1| 3-ketoacyl-CoA synthase 10 [Gossypium raimondii] 60 3e-07 gb|ABX10440.1| 3-ketoacyl-CoA synthase 10 [Gossypium hirsutum] 60 3e-07 ref|XP_002301436.2| fatty acid elongase 3-ketoacyl-CoA synthase ... 60 4e-07 ref|XP_004133789.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [C... 59 5e-07 gb|EOX95607.1| 3-ketoacyl-CoA synthase 1 [Theobroma cacao] 57 2e-06 ref|XP_006418385.1| hypothetical protein EUTSA_v10007351mg [Eutr... 57 3e-06 gb|AGK29997.1| 3-ketoacyl-CoA synthase [Gossypium raimondii] 56 4e-06 gb|AAC99312.1| fatty acid elongase 3-ketoacyl-CoA synthase 1 [Ar... 56 4e-06 ref|NP_171620.2| 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana... 56 4e-06 ref|XP_002889383.1| 3-ketoacyl-CoA synthase 1 [Arabidopsis lyrat... 56 4e-06 dbj|BAE98925.1| putative fatty acid elongase 3-ketoacyl-CoA synt... 56 4e-06 dbj|BAD95286.1| putative fatty acid elongase 3-ketoacyl-CoA synt... 56 4e-06 >ref|XP_006444749.1| hypothetical protein CICLE_v10019672mg [Citrus clementina] gi|568876576|ref|XP_006491353.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Citrus sinensis] gi|557547011|gb|ESR57989.1| hypothetical protein CICLE_v10019672mg [Citrus clementina] Length = 531 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVW+AL ++ VGN R N WV SI+KYPVK+N+A Sbjct: 492 SGFKCNSAVWRALMDIPVGNWRGNAWVDSIDKYPVKLNVA 531 >ref|XP_006444748.1| hypothetical protein CICLE_v10019672mg [Citrus clementina] gi|557547010|gb|ESR57988.1| hypothetical protein CICLE_v10019672mg [Citrus clementina] Length = 495 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVW+AL ++ VGN R N WV SI+KYPVK+N+A Sbjct: 456 SGFKCNSAVWRALMDIPVGNWRGNAWVDSIDKYPVKLNVA 495 >ref|XP_006375382.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa] gi|550323868|gb|ERP53179.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa] Length = 525 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVWKALR++ G + NPW+ SI++YPVKV +A Sbjct: 486 SGFKCNSAVWKALRKIPAGESKGNPWIDSIDRYPVKVPVA 525 >ref|XP_002529975.1| acyltransferase, putative [Ricinus communis] gi|223530537|gb|EEF32418.1| acyltransferase, putative [Ricinus communis] Length = 527 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVWKALR + G R+NPW SI++YPVKV +A Sbjct: 488 SGFKCNSAVWKALRAIPCGESRSNPWADSIDRYPVKVPVA 527 >gb|EMJ20182.1| hypothetical protein PRUPE_ppa003977mg [Prunus persica] Length = 537 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNL 117 SGFKCNSAVW+ALR + VG+ NPW+ SI++YPVKV++ Sbjct: 498 SGFKCNSAVWRALRPISVGDGLGNPWMDSIDRYPVKVSI 536 >emb|CBI38700.3| unnamed protein product [Vitis vinifera] Length = 714 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVW++LRE+ VG NPW S+++YPVKV Sbjct: 498 SGFKCNSAVWRSLREIPVGESGDNPWADSVDRYPVKV 534 >ref|XP_002264721.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Vitis vinifera] Length = 530 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVW++LRE+ VG NPW S+++YPVKV Sbjct: 487 SGFKCNSAVWRSLREIPVGESGDNPWADSVDRYPVKV 523 >gb|EXB83831.1| 3-ketoacyl-CoA synthase 1 [Morus notabilis] Length = 534 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVWKALREV VG NPW I++YPVKV A Sbjct: 495 SGFKCNSAVWKALREVPVGEFLGNPWNDCIDRYPVKVPTA 534 >gb|AGK29993.1| 3-ketoacyl-CoA synthase 10 [Gossypium raimondii] Length = 531 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVW+ALR + R NPW IEKYPVKV+ A Sbjct: 492 SGFKCNSAVWRALRSTPMAESRGNPWKNEIEKYPVKVSFA 531 >gb|ABX10440.1| 3-ketoacyl-CoA synthase 10 [Gossypium hirsutum] Length = 531 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVW+ALR + R NPW IEKYPVKV+ A Sbjct: 492 SGFKCNSAVWRALRSTPMAESRGNPWKNEIEKYPVKVSFA 531 >ref|XP_002301436.2| fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] gi|550345250|gb|EEE80709.2| fatty acid elongase 3-ketoacyl-CoA synthase 1 family protein [Populus trichocarpa] Length = 527 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALRE+ G + NPW SI+ YPVKV Sbjct: 488 SGFKCNSAVWKALREIPAGESKGNPWNDSIDWYPVKV 524 >ref|XP_004133789.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Cucumis sativus] gi|449477978|ref|XP_004155182.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Cucumis sativus] Length = 528 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNC-RTNPWVGSIEKYPVKV 111 +GFKCNSAVWKALRE+ C R NPW+ SI+ +PVKV Sbjct: 488 AGFKCNSAVWKALREIPASECERVNPWIDSIDNFPVKV 525 >gb|EOX95607.1| 3-ketoacyl-CoA synthase 1 [Theobroma cacao] Length = 530 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNL 117 SGFKCNSAVW+ALR R NPW IEKYPVKV L Sbjct: 491 SGFKCNSAVWRALRSTPESESRGNPWKDEIEKYPVKVPL 529 >ref|XP_006418385.1| hypothetical protein EUTSA_v10007351mg [Eutrema salsugineum] gi|557096156|gb|ESQ36738.1| hypothetical protein EUTSA_v10007351mg [Eutrema salsugineum] Length = 528 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSIE YPVK+ Sbjct: 490 SGFKCNSAVWKALRAVSTEEMTGNAWAGSIENYPVKI 526 >gb|AGK29997.1| 3-ketoacyl-CoA synthase [Gossypium raimondii] Length = 533 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKVNLA 120 SGFKCNSAVW+ALR + R NPW ++KYPVK++++ Sbjct: 491 SGFKCNSAVWRALRSTPMSESRCNPWKDEMDKYPVKLDIS 530 >gb|AAC99312.1| fatty acid elongase 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] Length = 520 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSI++YPVKV Sbjct: 482 SGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKV 518 >ref|NP_171620.2| 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] gi|75192344|sp|Q9MAM3.1|KCS1_ARATH RecName: Full=3-ketoacyl-CoA synthase 1; Short=KCS-1; AltName: Full=Very long-chain fatty acid condensing enzyme 1; Short=VLCFA condensing enzyme 1 gi|6715643|gb|AAF26470.1|AC007323_11 T25K16.11 [Arabidopsis thaliana] gi|18377664|gb|AAL66982.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] gi|20465993|gb|AAM20218.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] gi|332189120|gb|AEE27241.1| 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] Length = 528 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSI++YPVKV Sbjct: 490 SGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKV 526 >ref|XP_002889383.1| 3-ketoacyl-CoA synthase 1 [Arabidopsis lyrata subsp. lyrata] gi|297335225|gb|EFH65642.1| 3-ketoacyl-CoA synthase 1 [Arabidopsis lyrata subsp. lyrata] Length = 528 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSI++YPVKV Sbjct: 490 SGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKV 526 >dbj|BAE98925.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] Length = 528 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSI++YPVKV Sbjct: 490 SGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKV 526 >dbj|BAD95286.1| putative fatty acid elongase 3-ketoacyl-CoA synthase 1 [Arabidopsis thaliana] Length = 126 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 1 SGFKCNSAVWKALREVEVGNCRTNPWVGSIEKYPVKV 111 SGFKCNSAVWKALR V N W GSI++YPVKV Sbjct: 88 SGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYPVKV 124