BLASTX nr result
ID: Achyranthes23_contig00029533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029533 (302 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHG28983.1| NBS-LRR protein [Cicer arietinum] 61 1e-07 ref|XP_004490619.1| PREDICTED: putative disease resistance prote... 61 1e-07 gb|EOX96585.1| LRR and NB-ARC domains-containing disease resista... 55 7e-06 gb|EOX96584.1| LRR and NB-ARC domains-containing disease resista... 55 7e-06 >gb|AHG28983.1| NBS-LRR protein [Cicer arietinum] Length = 957 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = +1 Query: 10 LNPCKLNYCEGLKTLPESMKSLTFLQRLEIGSCPCLEERCKE------PKIQHIPHVDII 171 L K+ YCEGL+ LPE M+ LT L+ LEI CP LEERCKE KI HIP ++ I Sbjct: 895 LRTMKIIYCEGLRYLPEGMQYLTSLEVLEIRECPTLEERCKEGTGEDWDKIAHIPKLN-I 953 Query: 172 RWR 180 WR Sbjct: 954 GWR 956 >ref|XP_004490619.1| PREDICTED: putative disease resistance protein RGA4-like isoform X1 [Cicer arietinum] Length = 1003 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = +1 Query: 10 LNPCKLNYCEGLKTLPESMKSLTFLQRLEIGSCPCLEERCKE------PKIQHIPHVDII 171 L K+ YCEGL+ LPE M+ LT L+ LEI CP LEERCKE KI HIP ++ I Sbjct: 941 LRTMKIIYCEGLRYLPEGMQYLTSLEVLEIRECPTLEERCKEGTGEDWDKIAHIPKLN-I 999 Query: 172 RWR 180 WR Sbjct: 1000 GWR 1002 >gb|EOX96585.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 2 [Theobroma cacao] Length = 1115 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/59 (50%), Positives = 36/59 (61%), Gaps = 6/59 (10%) Frame = +1 Query: 10 LNPCKLNYCEGLKTLPESMKSLTFLQRLEIGSCPCLEERCKEP------KIQHIPHVDI 168 L +L YCE L LP+SM+ LT LQ L I CPCLE RCK+ KI+HIP + I Sbjct: 1047 LREMELCYCENLLRLPQSMQRLTALQFLLIRGCPCLEMRCKKDTGADWHKIRHIPFIKI 1105 >gb|EOX96584.1| LRR and NB-ARC domains-containing disease resistance protein, putative isoform 1 [Theobroma cacao] Length = 1289 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/59 (50%), Positives = 36/59 (61%), Gaps = 6/59 (10%) Frame = +1 Query: 10 LNPCKLNYCEGLKTLPESMKSLTFLQRLEIGSCPCLEERCKEP------KIQHIPHVDI 168 L +L YCE L LP+SM+ LT LQ L I CPCLE RCK+ KI+HIP + I Sbjct: 1047 LREMELCYCENLLRLPQSMQRLTALQFLLIRGCPCLEMRCKKDTGADWHKIRHIPFIKI 1105