BLASTX nr result
ID: Achyranthes23_contig00029500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029500 (602 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC75135.1| hypothetical protein OsI_11326 [Oryza sativa Indi... 57 4e-06 gb|ABF95643.1| VQ motif family protein, expressed [Oryza sativa ... 57 4e-06 >gb|EEC75135.1| hypothetical protein OsI_11326 [Oryza sativa Indica Group] Length = 171 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 582 KPLKVVHISNPMKYKATPNEFRALVQGLTGRDA-VVDWSEDYHHHH 448 K +KVV+IS+PMK A+ EFRA+VQ LTGRD+ V D D+HHHH Sbjct: 37 KGIKVVYISSPMKLTASAEEFRAVVQELTGRDSNVADHDLDHHHHH 82 >gb|ABF95643.1| VQ motif family protein, expressed [Oryza sativa Japonica Group] Length = 177 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 582 KPLKVVHISNPMKYKATPNEFRALVQGLTGRDA-VVDWSEDYHHHH 448 K +KVV+IS+PMK A+ EFRA+VQ LTGRD+ V D D+HHHH Sbjct: 42 KGIKVVYISSPMKLTASAEEFRAVVQELTGRDSNVADHDLDHHHHH 87