BLASTX nr result
ID: Achyranthes23_contig00029482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029482 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516490.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 ref|XP_006355304.1| PREDICTED: uncharacterized protein LOC102598... 72 6e-11 ref|XP_002278525.2| PREDICTED: uncharacterized protein LOC100243... 72 6e-11 emb|CBI20602.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_004162983.1| PREDICTED: uncharacterized LOC101205923 [Cuc... 72 8e-11 ref|XP_004148428.1| PREDICTED: uncharacterized protein LOC101205... 72 8e-11 gb|EXB75637.1| hypothetical protein L484_026114 [Morus notabilis] 72 1e-10 ref|XP_006581468.1| PREDICTED: uncharacterized protein LOC100804... 71 1e-10 gb|EOY29836.1| Uncharacterized protein isoform 1 [Theobroma cacao] 71 1e-10 ref|XP_004245131.1| PREDICTED: uncharacterized protein LOC101243... 71 1e-10 ref|XP_003523758.1| PREDICTED: uncharacterized protein LOC100783... 71 1e-10 ref|XP_002308587.2| hypothetical protein POPTR_0006s25110g [Popu... 71 2e-10 ref|XP_006475982.1| PREDICTED: uncharacterized protein LOC102616... 70 2e-10 ref|XP_006475981.1| PREDICTED: uncharacterized protein LOC102616... 70 2e-10 ref|XP_006450753.1| hypothetical protein CICLE_v100072502mg, par... 70 2e-10 ref|XP_002324157.1| hypothetical protein POPTR_0018s04760g [Popu... 70 3e-10 gb|EMJ26666.1| hypothetical protein PRUPE_ppa000219mg [Prunus pe... 70 4e-10 gb|ESW09257.1| hypothetical protein PHAVU_009G112800g [Phaseolus... 69 7e-10 ref|XP_006826763.1| hypothetical protein AMTR_s00136p00081990 [A... 68 1e-09 ref|XP_004501087.1| PREDICTED: uncharacterized protein LOC101498... 68 1e-09 >ref|XP_002516490.1| conserved hypothetical protein [Ricinus communis] gi|223544310|gb|EEF45831.1| conserved hypothetical protein [Ricinus communis] Length = 1426 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK +QS+LVNWHVANLEIQDRSLYSSDF++FWQS Sbjct: 1389 GLVLCKILQSQLVNWHVANLEIQDRSLYSSDFELFWQS 1426 >ref|XP_006355304.1| PREDICTED: uncharacterized protein LOC102598748 [Solanum tuberosum] Length = 1439 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -1 Query: 288 LLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 L+LCKC+Q +LVNWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1403 LVLCKCIQLQLVNWHVANLEIQDRSLYSNDFELFWQS 1439 >ref|XP_002278525.2| PREDICTED: uncharacterized protein LOC100243932 [Vitis vinifera] Length = 1416 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/38 (76%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL++CK +QSRL+NWH+ANLEIQDRSLYS+DF++FWQS Sbjct: 1379 GLVVCKFIQSRLINWHIANLEIQDRSLYSNDFELFWQS 1416 >emb|CBI20602.3| unnamed protein product [Vitis vinifera] Length = 1439 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/38 (76%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL++CK +QSRL+NWH+ANLEIQDRSLYS+DF++FWQS Sbjct: 1402 GLVVCKFIQSRLINWHIANLEIQDRSLYSNDFELFWQS 1439 >ref|XP_004162983.1| PREDICTED: uncharacterized LOC101205923 [Cucumis sativus] Length = 1417 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL++CK +QSRL+NWHVANLEIQDRSLYS++FD+FWQS Sbjct: 1380 GLVVCKFLQSRLINWHVANLEIQDRSLYSNEFDMFWQS 1417 >ref|XP_004148428.1| PREDICTED: uncharacterized protein LOC101205923 [Cucumis sativus] Length = 1448 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL++CK +QSRL+NWHVANLEIQDRSLYS++FD+FWQS Sbjct: 1411 GLVVCKFLQSRLINWHVANLEIQDRSLYSNEFDMFWQS 1448 >gb|EXB75637.1| hypothetical protein L484_026114 [Morus notabilis] Length = 1448 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+L+NWHVANLEIQDRSLYSSDF +FWQS Sbjct: 1411 GLVLCKIFQSQLINWHVANLEIQDRSLYSSDFQLFWQS 1448 >ref|XP_006581468.1| PREDICTED: uncharacterized protein LOC100804207 [Glycine max] Length = 1447 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1410 GLVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1447 >gb|EOY29836.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1452 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1415 GLVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1452 >ref|XP_004245131.1| PREDICTED: uncharacterized protein LOC101243915 [Solanum lycopersicum] Length = 1439 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -1 Query: 288 LLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 L+LCKC+Q +L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1403 LVLCKCIQLQLLNWHVANLEIQDRSLYSNDFELFWQS 1439 >ref|XP_003523758.1| PREDICTED: uncharacterized protein LOC100783686 [Glycine max] Length = 1447 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1410 GLVLCKLFQSQLINWHVANLEIQDRSLYSNDFELFWQS 1447 >ref|XP_002308587.2| hypothetical protein POPTR_0006s25110g [Populus trichocarpa] gi|550337045|gb|EEE92110.2| hypothetical protein POPTR_0006s25110g [Populus trichocarpa] Length = 1412 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/38 (76%), Positives = 37/38 (97%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL++CK +QS+L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1375 GLVVCKILQSQLINWHVANLEIQDRSLYSNDFELFWQS 1412 >ref|XP_006475982.1| PREDICTED: uncharacterized protein LOC102616975 isoform X2 [Citrus sinensis] Length = 1428 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+LVNWHVANLEIQDR+LYS+DF++FWQS Sbjct: 1391 GLVLCKIFQSQLVNWHVANLEIQDRTLYSNDFELFWQS 1428 >ref|XP_006475981.1| PREDICTED: uncharacterized protein LOC102616975 isoform X1 [Citrus sinensis] Length = 1458 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+LVNWHVANLEIQDR+LYS+DF++FWQS Sbjct: 1421 GLVLCKIFQSQLVNWHVANLEIQDRTLYSNDFELFWQS 1458 >ref|XP_006450753.1| hypothetical protein CICLE_v100072502mg, partial [Citrus clementina] gi|557553979|gb|ESR63993.1| hypothetical protein CICLE_v100072502mg, partial [Citrus clementina] Length = 79 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+LVNWHVANLEIQDR+LYS+DF++FWQS Sbjct: 42 GLVLCKIFQSQLVNWHVANLEIQDRTLYSNDFELFWQS 79 >ref|XP_002324157.1| hypothetical protein POPTR_0018s04760g [Populus trichocarpa] gi|222865591|gb|EEF02722.1| hypothetical protein POPTR_0018s04760g [Populus trichocarpa] Length = 1416 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+ CK +QS+LVNWH+ANLEIQDRSLYS+DF++FWQS Sbjct: 1379 GLVACKILQSQLVNWHIANLEIQDRSLYSNDFELFWQS 1416 >gb|EMJ26666.1| hypothetical protein PRUPE_ppa000219mg [Prunus persica] Length = 1446 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GLLLCK QS+L+NWHVANLEIQDRSLYS+D ++FWQS Sbjct: 1409 GLLLCKIFQSQLINWHVANLEIQDRSLYSNDVELFWQS 1446 >gb|ESW09257.1| hypothetical protein PHAVU_009G112800g [Phaseolus vulgaris] Length = 1447 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+LCK QS+L+NWHVANLEIQDR LYS+DF++FWQS Sbjct: 1410 GLVLCKLFQSQLINWHVANLEIQDRFLYSNDFELFWQS 1447 >ref|XP_006826763.1| hypothetical protein AMTR_s00136p00081990 [Amborella trichopoda] gi|548831183|gb|ERM94000.1| hypothetical protein AMTR_s00136p00081990 [Amborella trichopoda] Length = 1454 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 288 LLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 LL+CKCVQ+RL++WHVANLEIQDRSLYS+D + FWQS Sbjct: 1418 LLVCKCVQARLIDWHVANLEIQDRSLYSNDPNKFWQS 1454 >ref|XP_004501087.1| PREDICTED: uncharacterized protein LOC101498285 [Cicer arietinum] Length = 1454 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = -1 Query: 291 GLLLCKCVQSRLVNWHVANLEIQDRSLYSSDFDVFWQS 178 GL+L K +QS+L+NWHVANLEIQDRSLYS+DF++FWQS Sbjct: 1417 GLVLFKLLQSQLINWHVANLEIQDRSLYSNDFELFWQS 1454