BLASTX nr result
ID: Achyranthes23_contig00029249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029249 (483 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006378644.1| hypothetical protein POPTR_0010s18930g [Popu... 57 3e-06 >ref|XP_006378644.1| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] gi|566191579|ref|XP_002315122.2| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] gi|566191581|ref|XP_006378645.1| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] gi|550330125|gb|ERP56441.1| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] gi|550330126|gb|EEF01293.2| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] gi|550330127|gb|ERP56442.1| hypothetical protein POPTR_0010s18930g [Populus trichocarpa] Length = 556 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 8/95 (8%) Frame = -1 Query: 480 NFYDIVEDKLCRKQNNRTVEQRSSESPSEDGGNIDN--NSNLDPSSQV--NPSVDSLIST 313 N YDIVEDKLC+K+ + + + S +DG N + +N PSS V N S+IS Sbjct: 459 NSYDIVEDKLCQKEMDSSNQMPQSPFSGKDGSNPSSPLGNNSSPSSDVITNSPSPSIISK 518 Query: 312 GDPSFGR----TEEQSLREGMSKPMTPPSPLMIEK 220 G + G+ +E+ R G + MTPP+P +IE+ Sbjct: 519 GHVTPGKHLPMVKEEPSRGGKDETMTPPAPSLIER 553