BLASTX nr result
ID: Achyranthes23_contig00029198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029198 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002068174.1| GK12686 [Drosophila willistoni] gi|194164259... 57 2e-06 >ref|XP_002068174.1| GK12686 [Drosophila willistoni] gi|194164259|gb|EDW79160.1| GK12686 [Drosophila willistoni] Length = 308 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = +2 Query: 11 GYRGSVPQQNMQQQYYPTSGNQLMRPSQGLPS-SVPIQS--GPSVPNLGILPTGLSSSGM 181 GY +P + Q P G P++GLP+ +P + P +PN G+ G+ + G+ Sbjct: 96 GYNHGIPNPGIPNQGIPNPGI----PNRGLPNPGIPNEGIPNPGIPNRGLPNPGIPNPGL 151 Query: 182 PIPGRPNSGV-SPGLPTSGIPTPSLQN 259 P PG PN G+ +PG+P G+P P + N Sbjct: 152 PNPGIPNDGLPNPGIPNRGLPNPGIPN 178