BLASTX nr result
ID: Achyranthes23_contig00029024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00029024 (553 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006287181.1| hypothetical protein CARUB_v10000350mg [Caps... 73 5e-11 ref|XP_002454841.1| hypothetical protein SORBIDRAFT_04g038310 [S... 72 9e-11 gb|EMT19439.1| Oligopeptidase A [Aegilops tauschii] 72 1e-10 dbj|BAJ99666.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 1e-10 pdb|4KA8|A Chain A, Structure Of Organellar Oligopeptidase 71 2e-10 pdb|4KA7|A Chain A, Structure Of Organellar Oligopeptidase (e572... 71 2e-10 ref|NP_568232.1| zincin-like metalloproteases family protein [Ar... 71 2e-10 dbj|BAA98181.1| oligopeptidase A [Arabidopsis thaliana] 71 2e-10 ref|XP_002871425.1| hypothetical protein ARALYDRAFT_487887 [Arab... 71 2e-10 ref|XP_002527223.1| oligopeptidase A, putative [Ricinus communis... 71 2e-10 emb|CAB89389.1| oligopeptidase A-like protein [Arabidopsis thali... 71 2e-10 ref|NP_569013.1| zincin-like metalloproteases family protein [Ar... 71 2e-10 ref|XP_006648170.1| PREDICTED: thimet oligopeptidase-like [Oryza... 70 3e-10 ref|XP_004954508.1| PREDICTED: thimet oligopeptidase-like [Setar... 70 3e-10 ref|XP_006357764.1| PREDICTED: thimet oligopeptidase-like [Solan... 70 3e-10 ref|XP_004231980.1| PREDICTED: oligopeptidase A-like [Solanum ly... 70 3e-10 ref|XP_004137300.1| PREDICTED: oligopeptidase A-like [Cucumis sa... 70 3e-10 ref|XP_006399552.1| hypothetical protein EUTSA_v10012826mg [Eutr... 70 4e-10 gb|EMJ06163.1| hypothetical protein PRUPE_ppa002167mg [Prunus pe... 70 4e-10 ref|XP_002864966.1| peptidase M3 family protein [Arabidopsis lyr... 70 4e-10 >ref|XP_006287181.1| hypothetical protein CARUB_v10000350mg [Capsella rubella] gi|482555887|gb|EOA20079.1| hypothetical protein CARUB_v10000350mg [Capsella rubella] Length = 701 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL ATA Sbjct: 665 LALGGGKAPLQVFVEFRGREPSPEPLLRHNGLLAATA 701 >ref|XP_002454841.1| hypothetical protein SORBIDRAFT_04g038310 [Sorghum bicolor] gi|241934672|gb|EES07817.1| hypothetical protein SORBIDRAFT_04g038310 [Sorghum bicolor] Length = 766 Score = 72.0 bits (175), Expect = 9e-11 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK+PLEVFV FRGREPSPEPLLRHNGLLP A Sbjct: 730 LALGGGKSPLEVFVSFRGREPSPEPLLRHNGLLPVAA 766 >gb|EMT19439.1| Oligopeptidase A [Aegilops tauschii] Length = 740 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK+PLEVFV FRGREPSPEPLLRHNGLLP A Sbjct: 704 LALGGGKSPLEVFVAFRGREPSPEPLLRHNGLLPVAA 740 >dbj|BAJ99666.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 790 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK+PLEVFV FRGREPSPEPLLRHNGLLP A Sbjct: 754 LALGGGKSPLEVFVAFRGREPSPEPLLRHNGLLPVAA 790 >pdb|4KA8|A Chain A, Structure Of Organellar Oligopeptidase Length = 714 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 676 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 712 >pdb|4KA7|A Chain A, Structure Of Organellar Oligopeptidase (e572q) In Complex With An Endogenous Substrate Length = 714 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 676 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 712 >ref|NP_568232.1| zincin-like metalloproteases family protein [Arabidopsis thaliana] gi|75306307|sp|Q949P2.1|COPDA_ARATH RecName: Full=Probable cytosolic oligopeptidase A; AltName: Full=Thimet metalloendopeptidase 2; AltName: Full=Zincin-like metalloproteases family protein 2 gi|15293089|gb|AAK93655.1| putative oligopeptidase A [Arabidopsis thaliana] gi|26983900|gb|AAN86202.1| putative oligopeptidase A [Arabidopsis thaliana] gi|332004178|gb|AED91561.1| zincin-like metalloproteases family protein [Arabidopsis thaliana] Length = 701 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 665 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 701 >dbj|BAA98181.1| oligopeptidase A [Arabidopsis thaliana] Length = 714 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 676 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 712 >ref|XP_002871425.1| hypothetical protein ARALYDRAFT_487887 [Arabidopsis lyrata subsp. lyrata] gi|297317262|gb|EFH47684.1| hypothetical protein ARALYDRAFT_487887 [Arabidopsis lyrata subsp. lyrata] Length = 695 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 659 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 695 >ref|XP_002527223.1| oligopeptidase A, putative [Ricinus communis] gi|223533399|gb|EEF35149.1| oligopeptidase A, putative [Ricinus communis] Length = 780 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PLEVFV+FRGREPSPEPLLRHNGLL A A Sbjct: 742 LALGGGKAPLEVFVQFRGREPSPEPLLRHNGLLSAAA 778 >emb|CAB89389.1| oligopeptidase A-like protein [Arabidopsis thaliana] Length = 723 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 687 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 723 >ref|NP_569013.1| zincin-like metalloproteases family protein [Arabidopsis thaliana] gi|75306334|sp|Q94AM1.1|OOPDA_ARATH RecName: Full=Organellar oligopeptidase A, chloroplastic/mitochondrial; AltName: Full=Thimet metalloendopeptidase 1; AltName: Full=Zincin-like metalloproteases family protein 1; Flags: Precursor gi|15028227|gb|AAK76610.1| putative oligopeptidase A [Arabidopsis thaliana] gi|23297000|gb|AAN13220.1| putative oligopeptidase A [Arabidopsis thaliana] gi|332010695|gb|AED98078.1| zincin-like metalloproteases family protein [Arabidopsis thaliana] Length = 791 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 753 LALGGGKAPLKVFVEFRGREPSPEPLLRHNGLLAASA 789 >ref|XP_006648170.1| PREDICTED: thimet oligopeptidase-like [Oryza brachyantha] Length = 758 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK+PLEVFV FRGREPSPE LLRHNGLLPA A Sbjct: 722 LALGGGKSPLEVFVSFRGREPSPEALLRHNGLLPAAA 758 >ref|XP_004954508.1| PREDICTED: thimet oligopeptidase-like [Setaria italica] Length = 780 Score = 70.5 bits (171), Expect = 3e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLP 451 LALGGGK+PLEVFV FRGREPSPEPLLRHNGLLP Sbjct: 744 LALGGGKSPLEVFVSFRGREPSPEPLLRHNGLLP 777 >ref|XP_006357764.1| PREDICTED: thimet oligopeptidase-like [Solanum tuberosum] Length = 811 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PLEVFV+FRGREPSPEPLLRHNGLL ++A Sbjct: 775 LALGGGKAPLEVFVQFRGREPSPEPLLRHNGLLTSSA 811 >ref|XP_004231980.1| PREDICTED: oligopeptidase A-like [Solanum lycopersicum] Length = 807 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PLEVFV+FRGREPSPEPLLRHNGLL ++A Sbjct: 771 LALGGGKAPLEVFVQFRGREPSPEPLLRHNGLLTSSA 807 >ref|XP_004137300.1| PREDICTED: oligopeptidase A-like [Cucumis sativus] gi|449483314|ref|XP_004156553.1| PREDICTED: oligopeptidase A-like [Cucumis sativus] Length = 798 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PLEVFVEFRGREPSPEPLLRHNGLL A Sbjct: 760 LALGGGKAPLEVFVEFRGREPSPEPLLRHNGLLAGLA 796 >ref|XP_006399552.1| hypothetical protein EUTSA_v10012826mg [Eutrema salsugineum] gi|557100642|gb|ESQ41005.1| hypothetical protein EUTSA_v10012826mg [Eutrema salsugineum] Length = 701 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPAT 445 LALGGGK PL+VFVEFRGREPSPEPLLRHNGLL A+ Sbjct: 665 LALGGGKAPLQVFVEFRGREPSPEPLLRHNGLLAAS 700 >gb|EMJ06163.1| hypothetical protein PRUPE_ppa002167mg [Prunus persica] Length = 706 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGGK PLEVFVEFRGREPSPEPLLRHNGLL ATA Sbjct: 669 LALGGGKAPLEVFVEFRGREPSPEPLLRHNGLL-ATA 704 >ref|XP_002864966.1| peptidase M3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297310801|gb|EFH41225.1| peptidase M3 family protein [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -2 Query: 552 LALGGGKTPLEVFVEFRGREPSPEPLLRHNGLLPATA 442 LALGGG+ PL+VFVEFRGREPSPEPLLRHNGLL A+A Sbjct: 752 LALGGGRAPLKVFVEFRGREPSPEPLLRHNGLLAASA 788