BLASTX nr result
ID: Achyranthes23_contig00028364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00028364 (681 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006475231.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_006452171.1| hypothetical protein CICLE_v10008545mg [Citr... 61 4e-07 ref|XP_004307303.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 gb|EMJ15850.1| hypothetical protein PRUPE_ppa001961mg [Prunus pe... 58 2e-06 gb|EPS70908.1| hypothetical protein M569_03851, partial [Genlise... 57 5e-06 ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 emb|CBI20513.3| unnamed protein product [Vitis vinifera] 56 9e-06 >ref|XP_006475231.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Citrus sinensis] Length = 773 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LSYL MY+AFL SG ++A+ LSK+PKDDPHVR V+ AC TY Sbjct: 705 LSYLWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTY 748 >ref|XP_006452171.1| hypothetical protein CICLE_v10008545mg [Citrus clementina] gi|557555397|gb|ESR65411.1| hypothetical protein CICLE_v10008545mg [Citrus clementina] Length = 395 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LSYL MY+AFL SG ++A+ LSK+PKDDPHVR V+ AC TY Sbjct: 327 LSYLWMYKAFLASGNRKSASKLLSKMPKDDPHVRFVIQACKQTY 370 >ref|XP_004307303.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 801 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LS+LRMYQA L SG +AA KIPKDDPHV+S++ AC TY Sbjct: 736 LSFLRMYQALLASGDRKAAKVLEHKIPKDDPHVQSIIEACKQTY 779 >gb|EMJ15850.1| hypothetical protein PRUPE_ppa001961mg [Prunus persica] Length = 736 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LS++RMYQA L +G +A+ LSKIPKDDPHVR+++ AC Y Sbjct: 661 LSFIRMYQALLAAGDCKASKILLSKIPKDDPHVRTIIKACKTIY 704 >gb|EPS70908.1| hypothetical protein M569_03851, partial [Genlisea aurea] Length = 747 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LS++RMYQAFL S ++A L KIPK+DPHV VL AC V Y Sbjct: 684 LSFVRMYQAFLASADKKSAAKLLKKIPKEDPHVVRVLEACRVAY 727 >ref|XP_002279701.2| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Vitis vinifera] Length = 848 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LS+LRMYQA L G ++A + L KIPKDDPHV V+ AC TY Sbjct: 784 LSFLRMYQACLACGDHKSAANILHKIPKDDPHVCCVIKACQTTY 827 >emb|CBI20513.3| unnamed protein product [Vitis vinifera] Length = 618 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +1 Query: 1 LSYLRMYQAFLVSGQMQAATHFLSKIPKDDPHVRSVLHACHVTY 132 LS+LRMYQA L G ++A + L KIPKDDPHV V+ AC TY Sbjct: 554 LSFLRMYQACLACGDHKSAANILHKIPKDDPHVCCVIKACQTTY 597