BLASTX nr result
ID: Achyranthes23_contig00028081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes23_contig00028081 (505 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237728.1| PREDICTED: probable beta-1,4-xylosyltransfer... 55 7e-06 ref|XP_004237727.1| PREDICTED: probable beta-1,4-xylosyltransfer... 55 7e-06 ref|XP_004148819.1| PREDICTED: probable glucuronoxylan glucurono... 55 1e-05 >ref|XP_004237728.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX10-like isoform 2 [Solanum lycopersicum] Length = 453 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 428 SGAGAHLFKSWAKYLNRSIILTPEGD 505 SGAGAHLFKSWA YLNRSIILTPEGD Sbjct: 188 SGAGAHLFKSWATYLNRSIILTPEGD 213 >ref|XP_004237727.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX10-like isoform 1 [Solanum lycopersicum] Length = 462 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +2 Query: 428 SGAGAHLFKSWAKYLNRSIILTPEGD 505 SGAGAHLFKSWA YLNRSIILTPEGD Sbjct: 197 SGAGAHLFKSWATYLNRSIILTPEGD 222 >ref|XP_004148819.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H-like [Cucumis sativus] gi|449524512|ref|XP_004169266.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H-like [Cucumis sativus] Length = 458 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 407 DIFYPLCSGAGAHLFKSWAKYLNRSIILTPEGD 505 D + SGAGAHLFKSWA Y+NRSIILTPEGD Sbjct: 186 DHIFVFPSGAGAHLFKSWATYINRSIILTPEGD 218